BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30342 (703 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31910.1 68414.m03921 GHMP kinase family protein contains TIG... 27 9.1 >At1g31910.1 68414.m03921 GHMP kinase family protein contains TIGRFAM profile TIGR01219: phosphomevalonate kinase; contains Pfam PF00288: GHMP kinases putative ATP-binding protein domain; similar to Phosphomevalonate kinase (EC 2.7.4.2) (Swiss-Prot:P24521) [Saccharomyces cerevisiae] Length = 505 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 48 FCFYTPINPKMVPGAFITNITKVKYYSPRLLNIVTYQAYLFNMTHQALS 194 + PIN ++ P ++ T VK SP+L Y+ L ++T Q++S Sbjct: 36 YAIVKPINEEVKPESWAWKWTDVKLTSPQLSRESMYKLSLNHLTLQSVS 84 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,642,642 Number of Sequences: 28952 Number of extensions: 256863 Number of successful extensions: 410 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -