BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30340 (850 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 30 2.0 03_02_0257 + 6907997-6908504,6909316-6909348,6910163-6910308 29 3.5 10_02_0195 + 6578384-6578629,6578710-6579300,6586302-6587512,658... 29 4.7 07_03_0244 - 15715047-15715163,15716672-15716824,15718629-157187... 29 6.2 04_01_0034 - 401208-402923 29 6.2 02_05_1351 - 35855543-35856751 29 6.2 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -3 Query: 623 FNLPIYLRS-QCLRTFRLSPNSPAGTPQSPTPLPRLLVIDGNVPSPLYVLKHLR 465 FNLP +LRS +C TF L P P P P P P ++ PSP + LR Sbjct: 20 FNLPPWLRSLRCPFTF-LCPPPPPPPPPPPPPPPPPPPLEVVSPSPRWRRPGLR 72 >03_02_0257 + 6907997-6908504,6909316-6909348,6910163-6910308 Length = 228 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -2 Query: 591 PENIQIISEFSGRHTPIANTAAPASCYRRERPFAFI 484 P +Q+++ +G + P+A A+ S YR R AF+ Sbjct: 165 PPPVQVLNRLTGSYDPVALGASSLSVYRSRRHQAFL 200 >10_02_0195 + 6578384-6578629,6578710-6579300,6586302-6587512, 6587593-6587844,6587932-6588042,6588133-6588214, 6588299-6588382,6588464-6588658 Length = 923 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 3/33 (9%) Frame = -3 Query: 578 RLSPNSPAGTPQSPTPLPRLLVI---DGNVPSP 489 +++PNSP P+ P+P P+ ++ D +VP P Sbjct: 488 QVAPNSPTTLPRQPSPAPQSYLVPPLDEHVPPP 520 >07_03_0244 - 15715047-15715163,15716672-15716824,15718629-15718748, 15718830-15719045,15719902-15719968,15720051-15720125, 15720607-15720698,15721053-15721154,15721642-15721711, 15721788-15721846,15721947-15722031,15722443-15722520, 15722627-15722725,15722819-15722910,15725572-15725661, 15725937-15725995,15727966-15728281,15728627-15728702, 15729998-15730308,15730577-15730634,15731082-15731092, 15731247-15731397,15733372-15733778 Length = 967 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 614 PIYLRSQCLRTFRLSPNSPAGTPQSPTPLPR 522 P +LR LR R + SPA P P+P PR Sbjct: 10 PTFLREVELRLLRCTLPSPATLPPPPSPPPR 40 >04_01_0034 - 401208-402923 Length = 571 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 572 SPNSPAGTPQSPTPLPRLLVIDGNVPSP 489 +P S A TP++P+ + RL+ IDG SP Sbjct: 87 APTSEAETPRTPSLVARLMGIDGLPDSP 114 >02_05_1351 - 35855543-35856751 Length = 402 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = -3 Query: 581 FRLSPNSPAGTPQSP---TPLPRLLVIDGNVPSP 489 F SPN P +P P TPLPR+ + PSP Sbjct: 168 FTRSPNPPPPSPSPPIPATPLPRVHPSSSSSPSP 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,092,917 Number of Sequences: 37544 Number of extensions: 449211 Number of successful extensions: 1203 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1202 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2362209084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -