BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30333 (823 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 26 0.48 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.64 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.64 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 23 2.6 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 4.5 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 4.5 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 4.5 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 4.5 AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced prot... 22 7.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 7.9 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 25.8 bits (54), Expect = 0.48 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 616 QLYPSPPTQPLRHSGLCFHGSTMKPSMDN 702 QL P+P + L+ SG+ GST +PS N Sbjct: 380 QLCPTPRSTHLKVSGINRVGSTRRPSRRN 408 Score = 23.4 bits (48), Expect = 2.6 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -3 Query: 617 CRARRRQWKLRRGVDGELQFRLLAVVNGRDAPSIRK*PRAGTSTEGVEDQES 462 C +RR LRRG DG LA+ N R + P+ G S + + S Sbjct: 528 CFCKRRTNTLRRGSDGS----QLAMRNDRSPSYSMQVPQQGASIDDSDPDPS 575 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 25.4 bits (53), Expect = 0.64 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 456 LQGFLIFHSFGGGTGSG 506 L+G +I HS+GGG G G Sbjct: 656 LRGSIIDHSYGGGFGFG 672 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 25.4 bits (53), Expect = 0.64 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 456 LQGFLIFHSFGGGTGSG 506 L+G +I HS+GGG G G Sbjct: 694 LRGSIIDHSYGGGFGFG 710 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 23.4 bits (48), Expect = 2.6 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -3 Query: 617 CRARRRQWKLRRGVDGELQFRLLAVVNGRDAPSIRK*PRAGTSTEGVEDQES 462 C +RR LRRG DG LA+ N R + P+ G S + + S Sbjct: 80 CFCKRRTNTLRRGSDGS----QLAMRNDRSPSYSMQVPQQGASIDDSDPDPS 127 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 4.5 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 127 PSRHYRSGLR 98 P RHYRSGL+ Sbjct: 139 PLRHYRSGLK 148 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 190 RWSCLWASGHQAGCRAPGSKAPSRHYR 110 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 190 RWSCLWASGHQAGCRAPGSKAPSRHYR 110 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 190 RWSCLWASGHQAGCRAPGSKAPSRHYR 110 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced protein 75 protein. Length = 36 Score = 21.8 bits (44), Expect = 7.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 161 MARCPQTRPSGVETILSTLSSARPE 235 +A+ P + T+ ST+SSA+PE Sbjct: 7 VAQLPHHLSPNMPTMDSTVSSAKPE 31 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 7.9 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -1 Query: 493 PPPKEWKIRNPC 458 PPP++WK + C Sbjct: 416 PPPEDWKPLDKC 427 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 251,000 Number of Sequences: 438 Number of extensions: 5983 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26217432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -