BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30332 (756 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1795.08c |||histone acetyltransferase complex subunit |Schiz... 26 6.7 SPCC970.12 |mis18||kinetochore protein Mis18|Schizosaccharomyces... 25 8.8 >SPCC1795.08c |||histone acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 985 Score = 25.8 bits (54), Expect = 6.7 Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 380 SIPVFTTPTESNLKSHHVFYSYPNFSVARQRY-EIRRKFVSVKAGERNM 523 ++P++ PTE+N + YP V+R Y + + K KA + + Sbjct: 603 NVPMYGPPTENNEYCEEISEKYPITPVSRFAYAKTKLKSTCAKASRKRL 651 >SPCC970.12 |mis18||kinetochore protein Mis18|Schizosaccharomyces pombe|chr 3|||Manual Length = 155 Score = 25.4 bits (53), Expect = 8.8 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +2 Query: 422 SHHVFYSYPNFSVARQRYEIRRKFVSVKAGERNMCIYLKRTCLDVTNVTGRVKNS 586 SH + S+ + F K + +C+Y + +C V G+V NS Sbjct: 41 SHREYLSFTLSDAVENSVRVEDTF---KRSDDGLCVYSELSCTRCNEVIGKVYNS 92 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,767,565 Number of Sequences: 5004 Number of extensions: 51697 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -