BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30332 (756 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73906-6|CAA98113.1| 824|Caenorhabditis elegans Hypothetical pr... 29 4.7 AF003140-6|AAD47122.2| 1145|Caenorhabditis elegans Hypothetical ... 28 8.2 >Z73906-6|CAA98113.1| 824|Caenorhabditis elegans Hypothetical protein D2030.6 protein. Length = 824 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +2 Query: 464 RQRYEIRRKFVSVKAGERNMCIYLKRTCLDVTNVTGRVKNSGNVIWNVTSLSYC 625 + RY+ +KF+ V+ N C+ L RT + G KN G+++ + C Sbjct: 509 KTRYDSLKKFLCVECPIPNQCVNL-RTLAGKSKDGGENKNLGSIVLKIVLQMIC 561 >AF003140-6|AAD47122.2| 1145|Caenorhabditis elegans Hypothetical protein C44E4.7 protein. Length = 1145 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 478 DSSQICFCKSGRTEHVYLPKTHLFRCYECN-WESEELW-*CYLECH 609 ++ + FC T Y+ + H + CY CN ESE + C + CH Sbjct: 787 ENMDLNFCTYKSTGRAYVTQ-HWYNCYTCNMMESEGVCSVCAINCH 831 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,320,225 Number of Sequences: 27780 Number of extensions: 294492 Number of successful extensions: 734 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -