BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30331 (709 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0487 + 6406826-6407086,6413538-6413996,6414401-6414570,641... 31 1.2 >04_01_0487 + 6406826-6407086,6413538-6413996,6414401-6414570, 6415146-6415175,6415777-6415939,6416020-6417132 Length = 731 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/46 (30%), Positives = 28/46 (60%) Frame = -2 Query: 306 NINICSL*QTSCVFFCNVNYE*DKLDECDFNVIFDIPSLSNMYVCV 169 +I++ ++ Q+S V + +D+ D V+ IPSL+N+Y+C+ Sbjct: 569 SISMVNIWQSSLVSIRRLALTIKDIDQDDLQVLGSIPSLTNLYLCL 614 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,978,981 Number of Sequences: 37544 Number of extensions: 228590 Number of successful extensions: 326 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 326 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -