BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30321 (671 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 1.7 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 3.0 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 4.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 6.9 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -3 Query: 498 SGWSREYSPFTTSPSRVSCWDL 433 S WS +P T ++CW L Sbjct: 305 STWSTVQTPTTVMSPTINCWSL 326 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 360 IMSKIMLPRSMSSHIPSRIPTPAITSPNTKP 452 ++S LP + S+ + + T T P+TKP Sbjct: 155 VISSTPLPPTTSTTTRTTLTTKFTTKPSTKP 185 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -1 Query: 428 RRCGDPRRNMRTHTSREHDLRHDRS 354 R+C D R H EHD R S Sbjct: 249 RQCDDHRDRPPRHFHEEHDTRRASS 273 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = +1 Query: 226 VLLFTPPPWKFFVYTCFASSPTLQPCATCSS 318 V F W F + + + CATCSS Sbjct: 909 VAAFGLDQWSSFYWNLLPIAVFILVCATCSS 939 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = +1 Query: 226 VLLFTPPPWKFFVYTCFASSPTLQPCATCSS 318 V F W F + + + CATCSS Sbjct: 909 VAAFGLDQWSSFYWNLLPIAVFILVCATCSS 939 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +3 Query: 333 RFQLPSNTPIMSKIMLPRSMSSHIPSRIPTPA 428 R LP+N +LP + ++ P P P+ Sbjct: 47 RLSLPTNPAFFHPGLLPLAWQANSPPSPPAPS 78 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,459 Number of Sequences: 336 Number of extensions: 3573 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -