BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30321 (671 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT016066-1|AAV36951.1| 138|Drosophila melanogaster LP12967p pro... 88 1e-17 AE014296-1422|AAF50443.2| 407|Drosophila melanogaster CG7072-PA... 88 1e-17 BT024400-1|ABC86462.1| 162|Drosophila melanogaster IP05056p pro... 85 6e-17 AE014296-1423|AAF50442.1| 162|Drosophila melanogaster CG7076-PA... 85 6e-17 AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA... 84 2e-16 AY061158-1|AAL28706.1| 180|Drosophila melanogaster LD12613p pro... 79 7e-15 AE014296-371|AAF47580.1| 180|Drosophila melanogaster CG1919-PA ... 79 7e-15 AY070590-1|AAL48061.1| 247|Drosophila melanogaster RE69226p pro... 76 5e-14 AE014296-795|AAF47864.2| 247|Drosophila melanogaster CG1259-PB ... 76 5e-14 BT010217-1|AAQ23535.1| 194|Drosophila melanogaster RH05746p pro... 71 1e-12 AE014296-370|AAF47579.2| 194|Drosophila melanogaster CG13935-PA... 71 1e-12 BT022916-1|AAY55332.1| 136|Drosophila melanogaster IP04416p pro... 68 1e-11 AE014296-793|AAF47862.1| 147|Drosophila melanogaster CG15007-PA... 68 1e-11 BT022412-1|AAY54828.1| 424|Drosophila melanogaster IP11572p pro... 68 1e-11 BT022352-1|AAY54768.1| 424|Drosophila melanogaster IP11272p pro... 68 1e-11 BT022288-1|AAY54704.1| 424|Drosophila melanogaster IP11372p pro... 68 1e-11 BT022236-1|AAY54652.1| 424|Drosophila melanogaster IP11472p pro... 68 1e-11 BT011017-1|AAR30177.1| 205|Drosophila melanogaster RH14104p pro... 67 2e-11 AE014297-503|AAF54090.1| 205|Drosophila melanogaster CG2360-PA ... 67 2e-11 AE014297-502|AAF54091.1| 221|Drosophila melanogaster CG1252-PA ... 67 2e-11 AE001572-14|AAD19804.1| 221|Drosophila melanogaster cuticle pro... 67 2e-11 AE001572-13|AAD19803.1| 205|Drosophila melanogaster cuticle pro... 67 2e-11 AE014298-801|AAF46087.1| 145|Drosophila melanogaster CG4052-PA ... 66 3e-11 AE014296-3163|AAF49152.1| 198|Drosophila melanogaster CG9290-PA... 66 3e-11 AE014297-500|AAF54093.1| 199|Drosophila melanogaster CG2341-PA ... 65 9e-11 AE014297-498|AAF54095.1| 151|Drosophila melanogaster CG1331-PA ... 65 9e-11 AE014296-3164|AAF49151.1| 401|Drosophila melanogaster CG9295-PB... 65 9e-11 AE014134-1731|AAN10713.1| 146|Drosophila melanogaster CG31876-P... 65 9e-11 AE001572-18|AAD19808.1| 151|Drosophila melanogaster cuticle pro... 65 9e-11 AE001572-16|AAD19806.1| 199|Drosophila melanogaster cuticle pro... 65 9e-11 BT023126-1|AAY55542.1| 245|Drosophila melanogaster IP08764p pro... 64 1e-10 BT023042-1|AAY55458.1| 245|Drosophila melanogaster IP08564p pro... 64 1e-10 BT022677-1|AAY55093.1| 202|Drosophila melanogaster IP07124p pro... 64 1e-10 AE014297-2676|AAF55678.2| 245|Drosophila melanogaster CG6240-PA... 64 1e-10 AE014296-794|AAF47863.1| 188|Drosophila melanogaster CG15008-PA... 64 1e-10 AY071302-1|AAL48924.1| 302|Drosophila melanogaster RE33041p pro... 62 9e-10 AM294620-1|CAL26618.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294619-1|CAL26617.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294618-1|CAL26616.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294617-1|CAL26615.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294616-1|CAL26614.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294615-1|CAL26613.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294613-1|CAL26611.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294612-1|CAL26610.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294611-1|CAL26609.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294610-1|CAL26608.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AM294609-1|CAL26607.1| 204|Drosophila melanogaster CG9283 protein. 62 9e-10 AE014296-3162|AAF49153.1| 204|Drosophila melanogaster CG9283-PA... 62 9e-10 AE014134-486|AAF51198.2| 302|Drosophila melanogaster CG2973-PA ... 62 9e-10 BT011451-1|AAR99109.1| 340|Drosophila melanogaster RE37955p pro... 61 1e-09 AY070676-1|AAL48147.1| 221|Drosophila melanogaster RH13984p pro... 61 1e-09 AE014134-1758|AAN10718.1| 340|Drosophila melanogaster CG33302-P... 61 1e-09 Y18453-1|CAA77177.1| 472|Drosophila melanogaster drosocrystalli... 59 5e-09 M71249-1|AAA28501.1| 188|Drosophila melanogaster cuticle protei... 59 5e-09 AY119178-1|AAM51038.1| 477|Drosophila melanogaster RH66281p pro... 59 5e-09 AM294614-1|CAL26612.1| 204|Drosophila melanogaster CG9283 protein. 59 5e-09 AE014297-496|AAF54097.2| 188|Drosophila melanogaster CG2345-PA ... 59 5e-09 AE014134-2114|AAF53134.2| 477|Drosophila melanogaster CG16963-P... 59 5e-09 AE001572-20|AAD19810.1| 188|Drosophila melanogaster pupal-cutic... 59 5e-09 AE014134-1650|AAF52783.2| 153|Drosophila melanogaster CG3818-PA... 59 6e-09 AE014134-1730|AAN10712.1| 146|Drosophila melanogaster CG31878-P... 58 8e-09 AE014134-1729|AAN10711.1| 106|Drosophila melanogaster CG31878-P... 58 8e-09 AY070633-1|AAL48104.1| 192|Drosophila melanogaster RH01578p pro... 58 1e-08 AE014297-501|AAF54092.1| 217|Drosophila melanogaster CG1327-PA ... 58 1e-08 AE014296-792|AAF47861.1| 192|Drosophila melanogaster CG15006-PA... 58 1e-08 AE001572-15|AAD19805.1| 217|Drosophila melanogaster cuticle pro... 58 1e-08 AY070951-1|AAL48573.1| 208|Drosophila melanogaster RE04882p pro... 57 2e-08 AE014297-499|AAF54094.1| 208|Drosophila melanogaster CG1330-PA ... 57 2e-08 AE001572-17|AAD19807.1| 208|Drosophila melanogaster cuticle pro... 57 2e-08 AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA... 55 8e-08 AY121656-1|AAM51983.1| 206|Drosophila melanogaster RE04513p pro... 53 3e-07 AE014297-497|AAF54096.1| 191|Drosophila melanogaster CG2342-PA ... 53 3e-07 AE001572-19|AAD19809.1| 191|Drosophila melanogaster cuticle pro... 53 3e-07 AY071231-1|AAL48853.1| 217|Drosophila melanogaster RE26879p pro... 52 5e-07 AE013599-2993|AAF57484.2| 217|Drosophila melanogaster CG9036-PA... 52 5e-07 AE013599-2342|AAF57953.1| 620|Drosophila melanogaster CG15920-P... 51 2e-06 AY060758-1|AAL28306.1| 178|Drosophila melanogaster GH20904p pro... 49 5e-06 AE013599-1764|AAF58336.1| 178|Drosophila melanogaster CG6305-PA... 49 5e-06 BT024343-1|ABC86405.1| 266|Drosophila melanogaster IP09562p pro... 47 2e-05 AE014296-1421|AAF50444.1| 266|Drosophila melanogaster CG13670-P... 47 2e-05 AY071527-1|AAL49149.1| 270|Drosophila melanogaster RE57183p pro... 44 3e-04 AY071448-1|AAL49070.1| 815|Drosophila melanogaster RE53044p pro... 44 3e-04 AE014296-1500|AAF50383.2| 270|Drosophila melanogaster CG32029-P... 44 3e-04 AE013599-1762|AAF58339.2| 815|Drosophila melanogaster CG13338-P... 44 3e-04 AM294624-1|CAL26622.1| 143|Drosophila melanogaster CG13934 prot... 41 0.002 AM294629-1|CAL26627.1| 143|Drosophila melanogaster CG13934 prot... 38 0.009 AM294628-1|CAL26626.1| 143|Drosophila melanogaster CG13934 prot... 38 0.009 AM294627-1|CAL26625.1| 143|Drosophila melanogaster CG13934 prot... 38 0.009 AM294626-1|CAL26624.1| 143|Drosophila melanogaster CG13934 prot... 38 0.009 AM294623-1|CAL26621.1| 143|Drosophila melanogaster CG13934 prot... 38 0.009 AM294621-1|CAL26619.1| 143|Drosophila melanogaster CG13934 prot... 38 0.009 AY071564-1|AAL49186.1| 124|Drosophila melanogaster RE63063p pro... 38 0.012 AE014296-2695|AAF49493.1| 124|Drosophila melanogaster CG13041-P... 38 0.012 AE014296-369|AAF47578.1| 143|Drosophila melanogaster CG13934-PA... 38 0.016 AM294630-1|CAL26628.1| 143|Drosophila melanogaster CG13934 prot... 37 0.022 AM294625-1|CAL26623.1| 143|Drosophila melanogaster CG13934 prot... 37 0.029 AM294622-1|CAL26620.1| 143|Drosophila melanogaster CG13934 prot... 37 0.029 BT023021-1|AAY55437.1| 133|Drosophila melanogaster IP04071p pro... 36 0.050 AY071377-1|AAL48999.1| 131|Drosophila melanogaster RE40431p pro... 35 0.088 AE014296-2696|AAF49492.1| 131|Drosophila melanogaster CG13060-P... 35 0.088 AY084169-1|AAL89907.1| 123|Drosophila melanogaster RE40783p pro... 34 0.20 AY070997-1|AAL48619.1| 144|Drosophila melanogaster RE08808p pro... 34 0.20 AE014296-2686|AAF49501.1| 123|Drosophila melanogaster CG4962-PA... 34 0.20 AE013599-1904|AAF58238.1| 144|Drosophila melanogaster CG10112-P... 34 0.20 DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup prote... 33 0.27 DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup prote... 33 0.35 DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup prote... 33 0.35 AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p pro... 33 0.35 AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transm... 33 0.35 AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-P... 33 0.35 DQ375977-1|ABD37868.1| 431|Drosophila melanogaster catsup prote... 33 0.47 DQ375966-1|ABD37857.1| 431|Drosophila melanogaster catsup prote... 33 0.47 DQ375955-1|ABD37846.1| 431|Drosophila melanogaster catsup prote... 33 0.47 DQ375954-1|ABD37845.1| 431|Drosophila melanogaster catsup prote... 33 0.47 DQ375923-1|ABD37814.1| 431|Drosophila melanogaster catsup prote... 33 0.47 DQ375912-1|ABD37803.1| 431|Drosophila melanogaster catsup prote... 33 0.47 DQ375905-1|ABD37796.1| 431|Drosophila melanogaster catsup prote... 33 0.47 DQ375857-1|ABD37748.1| 431|Drosophila melanogaster catsup prote... 33 0.47 DQ375839-1|ABD37730.1| 431|Drosophila melanogaster catsup prote... 33 0.47 DQ375834-1|ABD37725.1| 431|Drosophila melanogaster catsup prote... 33 0.47 AE013599-1213|AAF58716.1| 100|Drosophila melanogaster CG13231-P... 32 0.62 AE014296-2697|AAF49491.2| 155|Drosophila melanogaster CG13059-P... 31 1.4 L07551-1|AAA28464.1| 808|Drosophila melanogaster protein ( Dros... 30 3.3 L07550-1|AAA28463.1| 701|Drosophila melanogaster protein ( Dros... 30 3.3 L07549-1|AAA28462.1| 808|Drosophila melanogaster protein ( Dros... 30 3.3 L06423-1|AAA28543.1| 808|Drosophila melanogaster steroid recept... 30 3.3 BT022990-1|AAY55406.1| 155|Drosophila melanogaster IP08464p pro... 30 3.3 AY069676-1|AAL39821.1| 808|Drosophila melanogaster LD45021p pro... 30 3.3 AF245116-1|AAF66981.1| 743|Drosophila melanogaster cactin protein. 30 3.3 AE014298-3022|AAF50904.2| 762|Drosophila melanogaster CG1676-PA... 30 3.3 AE014296-861|AAF47911.2| 456|Drosophila melanogaster CG11350-PB... 30 3.3 AE014134-3374|AAN11109.1| 701|Drosophila melanogaster CG8676-PC... 30 3.3 AE014134-3373|AAN11108.1| 808|Drosophila melanogaster CG8676-PD... 30 3.3 AE014134-3372|AAF53984.1| 808|Drosophila melanogaster CG8676-PB... 30 3.3 AE014134-3371|AAN11107.1| 808|Drosophila melanogaster CG8676-PA... 30 3.3 BT021350-1|AAX33498.2| 155|Drosophila melanogaster LP19160p pro... 29 4.4 AY071099-1|AAL48721.1| 153|Drosophila melanogaster RE16005p pro... 29 4.4 AE014296-2688|AAF49499.1| 155|Drosophila melanogaster CG13044-P... 29 4.4 AE014296-1868|AAF50120.2| 153|Drosophila melanogaster CG14147-P... 29 4.4 L02111-1|AAA28405.1| 865|Drosophila melanogaster calcium-bindin... 29 5.8 BT024389-1|ABC86451.1| 122|Drosophila melanogaster IP05464p pro... 29 7.6 BT004856-1|AAO45212.1| 372|Drosophila melanogaster RE59371p pro... 29 7.6 AY094890-1|AAM11243.1| 517|Drosophila melanogaster RE59303p pro... 29 7.6 AY061577-1|AAL29125.1| 558|Drosophila melanogaster SD02805p pro... 29 7.6 AY060872-1|AAL28420.1| 390|Drosophila melanogaster GM03781p pro... 29 7.6 AE014297-2840|AAF55794.1| 381|Drosophila melanogaster CG5494-PA... 29 7.6 AE014297-2348|ABC66180.1| 151|Drosophila melanogaster CG34053-P... 29 7.6 AE014296-2698|AAF49490.1| 185|Drosophila melanogaster CG13040-P... 29 7.6 AE014296-2379|AAF49745.1| 102|Drosophila melanogaster CG13482-P... 29 7.6 AE014134-1581|AAF52726.1| 517|Drosophila melanogaster CG31886-P... 29 7.6 AE013599-1008|AAF58850.1| 372|Drosophila melanogaster CG12920-P... 29 7.6 AE013599-591|AAF59133.4| 1155|Drosophila melanogaster CG30372-PB... 29 7.6 >BT016066-1|AAV36951.1| 138|Drosophila melanogaster LP12967p protein. Length = 138 Score = 87.8 bits (208), Expect = 1e-17 Identities = 42/75 (56%), Positives = 53/75 (70%), Gaps = 2/75 (2%) Frame = +2 Query: 290 HFSP--VQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGD 463 H++P V HAPV+ HA H+ H E A KY F+Y ++DPHTGD KSQ E RDGD Sbjct: 23 HYAPALVHHAPVLSHAV------HAVHAEPVAYPKYSFNYGIKDPHTGDIKSQAEERDGD 76 Query: 464 VVKGEYSLLQPDGSI 508 VVKG+YSL++PDGS+ Sbjct: 77 VVKGQYSLVEPDGSV 91 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 147 ATAHYTPV-LSHAAPVLTHAAPLIQHAGPIVHAAPV 251 A A P+ L H AP L H AP++ HA VHA PV Sbjct: 12 AAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPV 47 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +3 Query: 513 VEYTADHHNGFNAIVHNS 566 V+YTAD HNGFNA+VH + Sbjct: 94 VDYTADDHNGFNAVVHKT 111 >AE014296-1422|AAF50443.2| 407|Drosophila melanogaster CG7072-PA protein. Length = 407 Score = 87.8 bits (208), Expect = 1e-17 Identities = 42/75 (56%), Positives = 53/75 (70%), Gaps = 2/75 (2%) Frame = +2 Query: 290 HFSP--VQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGD 463 H++P V HAPV+ HA H+ H E A KY F+Y ++DPHTGD KSQ E RDGD Sbjct: 62 HYAPALVHHAPVLSHAV------HAVHAEPVAYPKYSFNYGIKDPHTGDIKSQAEERDGD 115 Query: 464 VVKGEYSLLQPDGSI 508 VVKG+YSL++PDGS+ Sbjct: 116 VVKGQYSLVEPDGSV 130 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 147 ATAHYTPV-LSHAAPVLTHAAPLIQHAGPIVHAAPV 251 A A P+ L H AP L H AP++ HA VHA PV Sbjct: 51 AAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPV 86 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +3 Query: 513 VEYTADHHNGFNAIVHNS 566 V+YTAD HNGFNA+VH + Sbjct: 133 VDYTADDHNGFNAVVHKT 150 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 380 PAKYEFSYSVEDPHTGDHKSQHETR-DGDVVKGEYSLLQPDGSI 508 P Y F Y + DP T + + + E R ++G Y +PDG I Sbjct: 154 PNTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRI 197 >BT024400-1|ABC86462.1| 162|Drosophila melanogaster IP05056p protein. Length = 162 Score = 85.4 bits (202), Expect = 6e-17 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 H +HV+ +AP KY F Y V D HTGD KSQHETRDGD VKG+YSL++PDGSI Sbjct: 77 HDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSI 128 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +3 Query: 513 VEYTADHHNGFNAIVHNS 566 V+YTAD HNGFNA+VH + Sbjct: 131 VDYTADKHNGFNAVVHKT 148 >AE014296-1423|AAF50442.1| 162|Drosophila melanogaster CG7076-PA protein. Length = 162 Score = 85.4 bits (202), Expect = 6e-17 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 H +HV+ +AP KY F Y V D HTGD KSQHETRDGD VKG+YSL++PDGSI Sbjct: 77 HDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSI 128 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +3 Query: 513 VEYTADHHNGFNAIVHNS 566 V+YTAD HNGFNA+VH + Sbjct: 131 VDYTADKHNGFNAVVHKT 148 >AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA protein. Length = 1242 Score = 83.8 bits (198), Expect = 2e-16 Identities = 37/70 (52%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = +2 Query: 302 VQHAPVVHHAAIPIAVE-HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGE 478 ++ APV HA + + E H +H + H +Y F Y+V DPHTGD+K Q E RDGDVVKGE Sbjct: 1139 LKSAPVTQHAVLKVVPEKHLEHFDAHP--RYAFEYAVNDPHTGDNKHQKEERDGDVVKGE 1196 Query: 479 YSLLQPDGSI 508 YSL++PDG++ Sbjct: 1197 YSLVEPDGNV 1206 >AY061158-1|AAL28706.1| 180|Drosophila melanogaster LD12613p protein. Length = 180 Score = 78.6 bits (185), Expect = 7e-15 Identities = 37/70 (52%), Positives = 46/70 (65%), Gaps = 3/70 (4%) Frame = +2 Query: 308 HAPVVHHAAIPIAVEHSDH---VEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGE 478 H ++ AA I H H ++ HA KY ++Y V D HTGD KSQHE RDGDVVKG Sbjct: 24 HGAGLYAAAPAIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGS 83 Query: 479 YSLLQPDGSI 508 YSL++PDGS+ Sbjct: 84 YSLVEPDGSV 93 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 513 VEYTADHHNGFNAIVHNS 566 VEYTAD HNGFNA+VH + Sbjct: 96 VEYTADDHNGFNAVVHKT 113 Score = 32.7 bits (71), Expect = 0.47 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 421 HA+P V H +P + HH A AV ++ + PA + Y+ + H Sbjct: 127 HAAPAVVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVPA---YGYATHNAH 174 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = +3 Query: 120 VRHDEPSHQATAHYTPVLSHAAPV----LTH---AAPLIQHAGPIVHAAP 248 V H P+ AH P + HAAP + H AAP + +AG + H P Sbjct: 117 VHHAAPA--VVAHAAPAVVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVP 164 >AE014296-371|AAF47580.1| 180|Drosophila melanogaster CG1919-PA protein. Length = 180 Score = 78.6 bits (185), Expect = 7e-15 Identities = 37/70 (52%), Positives = 46/70 (65%), Gaps = 3/70 (4%) Frame = +2 Query: 308 HAPVVHHAAIPIAVEHSDH---VEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGE 478 H ++ AA I H H ++ HA KY ++Y V D HTGD KSQHE RDGDVVKG Sbjct: 24 HGAGLYAAAPAIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGS 83 Query: 479 YSLLQPDGSI 508 YSL++PDGS+ Sbjct: 84 YSLVEPDGSV 93 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 513 VEYTADHHNGFNAIVHNS 566 VEYTAD HNGFNA+VH + Sbjct: 96 VEYTADDHNGFNAVVHKT 113 Score = 32.7 bits (71), Expect = 0.47 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 421 HA+P V H +P + HH A AV ++ + PA + Y+ + H Sbjct: 127 HAAPAVVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVPA---YGYATHNAH 174 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = +3 Query: 120 VRHDEPSHQATAHYTPVLSHAAPV----LTH---AAPLIQHAGPIVHAAP 248 V H P+ AH P + HAAP + H AAP + +AG + H P Sbjct: 117 VHHAAPA--VVAHAAPAVVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVP 164 >AY070590-1|AAL48061.1| 247|Drosophila melanogaster RE69226p protein. Length = 247 Score = 75.8 bits (178), Expect = 5e-14 Identities = 38/78 (48%), Positives = 52/78 (66%) Frame = +2 Query: 272 ASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHET 451 A+PV +P+ APV A P+A + + D P +Y+F+Y V+D TGD K+Q ET Sbjct: 109 AAPVAPVAAPLA-APVAAPLAAPVAAPIATEIVDAHP-QYKFAYDVQDTLTGDSKTQEET 166 Query: 452 RDGDVVKGEYSLLQPDGS 505 RDGDVV+G YSL++PDGS Sbjct: 167 RDGDVVRGSYSLIEPDGS 184 >AE014296-795|AAF47864.2| 247|Drosophila melanogaster CG1259-PB protein. Length = 247 Score = 75.8 bits (178), Expect = 5e-14 Identities = 38/78 (48%), Positives = 52/78 (66%) Frame = +2 Query: 272 ASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHET 451 A+PV +P+ APV A P+A + + D P +Y+F+Y V+D TGD K+Q ET Sbjct: 109 AAPVAPVAAPLA-APVAAPLAAPVAAPIATEIVDAHP-QYKFAYDVQDTLTGDSKTQEET 166 Query: 452 RDGDVVKGEYSLLQPDGS 505 RDGDVV+G YSL++PDGS Sbjct: 167 RDGDVVRGSYSLIEPDGS 184 >BT010217-1|AAQ23535.1| 194|Drosophila melanogaster RH05746p protein. Length = 194 Score = 70.9 bits (166), Expect = 1e-12 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 386 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 KY F+Y V D TGD KSQHETRDGDVVKG+YSL++PDGSI Sbjct: 34 KYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSI 74 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 114 SIVRHDEPS-HQATAHYTPVLSHAAPVLTHAAP-LIQHAGPIVHA 242 ++V P+ H +P+++H PVLTH P +++H P+ HA Sbjct: 89 AVVTKSGPTVHAQAVVASPIVAHK-PVLTHYEPQVVKHVAPVAHA 132 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 269 HASP-VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEF 397 H P VV+H +PV HAP+V + P +H AP Y++ Sbjct: 117 HYEPQVVKHVAPVAHAPLVVASPAPYVAKHYAPAA-AAPIHYDY 159 >AE014296-370|AAF47579.2| 194|Drosophila melanogaster CG13935-PA protein. Length = 194 Score = 70.9 bits (166), Expect = 1e-12 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 386 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 KY F+Y V D TGD KSQHETRDGDVVKG+YSL++PDGSI Sbjct: 34 KYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSI 74 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 114 SIVRHDEPS-HQATAHYTPVLSHAAPVLTHAAP-LIQHAGPIVHA 242 ++V P+ H +P+++H PVLTH P +++H P+ HA Sbjct: 89 AVVTKSGPTVHAQAVVASPIVAHK-PVLTHYEPQVVKHVAPVAHA 132 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 269 HASP-VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEF 397 H P VV+H +PV HAP+V + P +H AP Y++ Sbjct: 117 HYEPQVVKHVAPVAHAPLVVASPAPYVAKHYAPAA-AAPIHYDY 159 >BT022916-1|AAY55332.1| 136|Drosophila melanogaster IP04416p protein. Length = 136 Score = 68.1 bits (159), Expect = 1e-11 Identities = 32/69 (46%), Positives = 46/69 (66%) Frame = +2 Query: 329 AAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 AA+P+ V + V+ H +Y F+Y+V+D TGD KSQ E RDGDVVKG YS++ DGS+ Sbjct: 40 AAVPVGVPLNTEVDPHP--QYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSL 97 Query: 509 ASRIHS*PP 535 + ++ P Sbjct: 98 RTVFYTADP 106 >AE014296-793|AAF47862.1| 147|Drosophila melanogaster CG15007-PA protein. Length = 147 Score = 68.1 bits (159), Expect = 1e-11 Identities = 32/69 (46%), Positives = 46/69 (66%) Frame = +2 Query: 329 AAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 AA+P+ V + V+ H +Y F+Y+V+D TGD KSQ E RDGDVVKG YS++ DGS+ Sbjct: 51 AAVPVGVPLNTEVDPHP--QYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSL 108 Query: 509 ASRIHS*PP 535 + ++ P Sbjct: 109 RTVFYTADP 117 >BT022412-1|AAY54828.1| 424|Drosophila melanogaster IP11572p protein. Length = 424 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = +2 Query: 341 IAVEHSDHVEDHAP----AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 + ++ D ++AP Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSI Sbjct: 36 VVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 95 >BT022352-1|AAY54768.1| 424|Drosophila melanogaster IP11272p protein. Length = 424 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = +2 Query: 341 IAVEHSDHVEDHAP----AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 + ++ D ++AP Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSI Sbjct: 36 VVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 95 >BT022288-1|AAY54704.1| 424|Drosophila melanogaster IP11372p protein. Length = 424 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = +2 Query: 341 IAVEHSDHVEDHAP----AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 + ++ D ++AP Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSI Sbjct: 36 VVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 95 >BT022236-1|AAY54652.1| 424|Drosophila melanogaster IP11472p protein. Length = 424 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = +2 Query: 341 IAVEHSDHVEDHAP----AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 + ++ D ++AP Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSI Sbjct: 36 VVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 95 >BT011017-1|AAR30177.1| 205|Drosophila melanogaster RH14104p protein. Length = 205 Score = 67.3 bits (157), Expect = 2e-11 Identities = 36/78 (46%), Positives = 49/78 (62%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D TGD+K Q E Sbjct: 29 HAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKLTGDNKGQVE 81 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV+GEYSL+ DG Sbjct: 82 ERDGDVVRGEYSLIDADG 99 >AE014297-503|AAF54090.1| 205|Drosophila melanogaster CG2360-PA protein. Length = 205 Score = 67.3 bits (157), Expect = 2e-11 Identities = 36/78 (46%), Positives = 49/78 (62%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D TGD+K Q E Sbjct: 29 HAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKLTGDNKGQVE 81 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV+GEYSL+ DG Sbjct: 82 ERDGDVVRGEYSLIDADG 99 >AE014297-502|AAF54091.1| 221|Drosophila melanogaster CG1252-PA protein. Length = 221 Score = 67.3 bits (157), Expect = 2e-11 Identities = 36/78 (46%), Positives = 49/78 (62%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D TGD+K Q E Sbjct: 29 HAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKLTGDNKGQVE 81 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV+GEYSL+ DG Sbjct: 82 ERDGDVVRGEYSLIDADG 99 >AE001572-14|AAD19804.1| 221|Drosophila melanogaster cuticle protein protein. Length = 221 Score = 67.3 bits (157), Expect = 2e-11 Identities = 36/78 (46%), Positives = 49/78 (62%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D TGD+K Q E Sbjct: 29 HAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKLTGDNKGQVE 81 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV+GEYSL+ DG Sbjct: 82 ERDGDVVRGEYSLIDADG 99 >AE001572-13|AAD19803.1| 205|Drosophila melanogaster cuticle protein protein. Length = 205 Score = 67.3 bits (157), Expect = 2e-11 Identities = 36/78 (46%), Positives = 49/78 (62%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D TGD+K Q E Sbjct: 29 HAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKLTGDNKGQVE 81 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV+GEYSL+ DG Sbjct: 82 ERDGDVVRGEYSLIDADG 99 >AE014298-801|AAF46087.1| 145|Drosophila melanogaster CG4052-PA protein. Length = 145 Score = 66.5 bits (155), Expect = 3e-11 Identities = 33/78 (42%), Positives = 49/78 (62%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+PV + +P A V+ A P+ + + + H +Y+++Y V+D +GD KSQ E Sbjct: 27 HAAPVATYAAPAP-AAVLKTVAQPVLAKADEEYDPHP--QYKYAYDVQDAISGDSKSQVE 83 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV+GEYSL+ DG Sbjct: 84 ERDGDVVRGEYSLVDSDG 101 >AE014296-3163|AAF49152.1| 198|Drosophila melanogaster CG9290-PA protein. Length = 198 Score = 66.5 bits (155), Expect = 3e-11 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = +2 Query: 359 DHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 505 D E H KY+F Y V+D HTGD KSQ ETRDGD VKG YSL + DG+ Sbjct: 76 DKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGT 124 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGFNA+V Sbjct: 128 VEYTADDHNGFNAVV 142 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +3 Query: 93 GHAVSSQSIVRHDEPSHQATAH-YT-PVLSHAAPVLTHAAPLIQHAG 227 GHA S S+ +H+ P H++ + Y V+S + H P + H+G Sbjct: 24 GHATSYSSVTKHEGPVHKSLGYGYDHDVVSAYGGIYGHGYPSVGHSG 70 >AE014297-500|AAF54093.1| 199|Drosophila melanogaster CG2341-PA protein. Length = 199 Score = 64.9 bits (151), Expect = 9e-11 Identities = 33/78 (42%), Positives = 49/78 (62%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+P V ++ APV A P+ + ++ + H +Y+++Y V+D +GD KSQ E Sbjct: 27 HAAPAVATYA---QAPVAVAHAQPVLAKAAEEYDPHP--QYKYAYDVQDSLSGDSKSQVE 81 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV+GEYSL+ DG Sbjct: 82 ERDGDVVRGEYSLIDADG 99 >AE014297-498|AAF54095.1| 151|Drosophila melanogaster CG1331-PA protein. Length = 151 Score = 64.9 bits (151), Expect = 9e-11 Identities = 34/78 (43%), Positives = 48/78 (61%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+P V ++ APV A P+ + ++ + H +Y+F+Y V+D +GD KSQ E Sbjct: 27 HAAPAVATYA---QAPVAVAHAQPVLTKATEEYDPHP--QYKFAYDVQDSLSGDSKSQVE 81 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV GEYSL+ DG Sbjct: 82 ERDGDVVHGEYSLIDSDG 99 >AE014296-3164|AAF49151.1| 401|Drosophila melanogaster CG9295-PB protein. Length = 401 Score = 64.9 bits (151), Expect = 9e-11 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +2 Query: 389 YEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSI Sbjct: 33 YAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 72 >AE014134-1731|AAN10713.1| 146|Drosophila melanogaster CG31876-PA protein. Length = 146 Score = 64.9 bits (151), Expect = 9e-11 Identities = 30/61 (49%), Positives = 40/61 (65%) Frame = +2 Query: 320 VHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPD 499 ++H+ I VE APA Y+F+YSV D HTGD KSQ E+R GD V+G+Y+L+ D Sbjct: 22 IYHSPAAIVKPLLKTVEVEAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDAD 81 Query: 500 G 502 G Sbjct: 82 G 82 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 V+YT+D HNGFNA+V Sbjct: 87 VDYTSDAHNGFNAVV 101 >AE001572-18|AAD19808.1| 151|Drosophila melanogaster cuticle protein protein. Length = 151 Score = 64.9 bits (151), Expect = 9e-11 Identities = 34/78 (43%), Positives = 48/78 (61%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+P V ++ APV A P+ + ++ + H +Y+F+Y V+D +GD KSQ E Sbjct: 27 HAAPAVATYA---QAPVAVAHAQPVLTKATEEYDPHP--QYKFAYDVQDSLSGDSKSQVE 81 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV GEYSL+ DG Sbjct: 82 ERDGDVVHGEYSLIDSDG 99 >AE001572-16|AAD19806.1| 199|Drosophila melanogaster cuticle protein protein. Length = 199 Score = 64.9 bits (151), Expect = 9e-11 Identities = 33/78 (42%), Positives = 49/78 (62%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 HA+P V ++ APV A P+ + ++ + H +Y+++Y V+D +GD KSQ E Sbjct: 27 HAAPAVATYA---QAPVAVAHAQPVLAKAAEEYDPHP--QYKYAYDVQDSLSGDSKSQVE 81 Query: 449 TRDGDVVKGEYSLLQPDG 502 RDGDVV+GEYSL+ DG Sbjct: 82 ERDGDVVRGEYSLIDADG 99 >BT023126-1|AAY55542.1| 245|Drosophila melanogaster IP08764p protein. Length = 245 Score = 64.5 bits (150), Expect = 1e-10 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +2 Query: 386 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 505 KY F Y ++D +TGD KSQHETR GDVVKG YS++ PDG+ Sbjct: 67 KYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGT 106 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 V+YTAD H+GFNA+V Sbjct: 110 VDYTADPHHGFNAVV 124 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 114 SIVRHDEPSHQATAHYTPVLSHA-APVLTHAAPLIQHAGPIVHAAPV 251 ++VR + +++A AH PV++ A APV H P P V AP+ Sbjct: 122 AVVRKEPLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPL 168 >BT023042-1|AAY55458.1| 245|Drosophila melanogaster IP08564p protein. Length = 245 Score = 64.5 bits (150), Expect = 1e-10 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +2 Query: 386 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 505 KY F Y ++D +TGD KSQHETR GDVVKG YS++ PDG+ Sbjct: 67 KYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGT 106 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 V+YTAD H+GFNA+V Sbjct: 110 VDYTADPHHGFNAVV 124 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 114 SIVRHDEPSHQATAHYTPVLSHA-APVLTHAAPLIQHAGPIVHAAPV 251 ++VR + +++A AH PV++ A APV H P P V AP+ Sbjct: 122 AVVRKEPLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPL 168 >BT022677-1|AAY55093.1| 202|Drosophila melanogaster IP07124p protein. Length = 202 Score = 64.5 bits (150), Expect = 1e-10 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 2/81 (2%) Frame = +2 Query: 272 ASPVVQHFSP-VQHAPVVHHAAIPIAVEHSDHVEDHAP-AKYEFSYSVEDPHTGDHKSQH 445 A+P + + +P + +AP V A P+AV E + P +Y FSY V D HTGD K Q Sbjct: 67 AAPAISYAAPAISYAPKV--LAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQE 124 Query: 446 ETRDGDVVKGEYSLLQPDGSI 508 ET VV G YSL +PDG+I Sbjct: 125 ETLVNGVVHGSYSLAEPDGTI 145 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +3 Query: 180 AAPVLTHAAPLIQHAGPIVHAAPVEILRI 266 AAP +++AAP I +A P V AAPV + ++ Sbjct: 67 AAPAISYAAPAISYA-PKVLAAPVAVAKV 94 >AE014297-2676|AAF55678.2| 245|Drosophila melanogaster CG6240-PA protein. Length = 245 Score = 64.5 bits (150), Expect = 1e-10 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +2 Query: 386 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 505 KY F Y ++D +TGD KSQHETR GDVVKG YS++ PDG+ Sbjct: 67 KYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGT 106 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 V+YTAD H+GFNA+V Sbjct: 110 VDYTADPHHGFNAVV 124 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 114 SIVRHDEPSHQATAHYTPVLSHA-APVLTHAAPLIQHAGPIVHAAPV 251 ++VR + +++A AH PV++ A APV H P P V AP+ Sbjct: 122 AVVRKEPLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPL 168 >AE014296-794|AAF47863.1| 188|Drosophila melanogaster CG15008-PA protein. Length = 188 Score = 64.5 bits (150), Expect = 1e-10 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 2/81 (2%) Frame = +2 Query: 272 ASPVVQHFSP-VQHAPVVHHAAIPIAVEHSDHVEDHAP-AKYEFSYSVEDPHTGDHKSQH 445 A+P + + +P + +AP V A P+AV E + P +Y FSY V D HTGD K Q Sbjct: 53 AAPAISYAAPAISYAPKV--LAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQE 110 Query: 446 ETRDGDVVKGEYSLLQPDGSI 508 ET VV G YSL +PDG+I Sbjct: 111 ETLVNGVVHGSYSLAEPDGTI 131 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +3 Query: 180 AAPVLTHAAPLIQHAGPIVHAAPVEILRI 266 AAP +++AAP I +A P V AAPV + ++ Sbjct: 53 AAPAISYAAPAISYA-PKVLAAPVAVAKV 80 >AY071302-1|AAL48924.1| 302|Drosophila melanogaster RE33041p protein. Length = 302 Score = 61.7 bits (143), Expect = 9e-10 Identities = 34/87 (39%), Positives = 44/87 (50%) Frame = +2 Query: 242 RPRGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 421 R NS + ++ Q VQH + +H + E PA Y F+Y+V D Sbjct: 109 RHEQNSEVVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEP-EVFPPASYSFNYAVNDAS 167 Query: 422 TGDHKSQHETRDGDVVKGEYSLLQPDG 502 TGD K ETRDG VV+G YSL+ PDG Sbjct: 168 TGDIKEHSETRDGYVVRGFYSLIDPDG 194 >AM294620-1|CAL26618.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AM294619-1|CAL26617.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AM294618-1|CAL26616.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AM294617-1|CAL26615.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AM294616-1|CAL26614.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AM294615-1|CAL26613.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 >AM294613-1|CAL26611.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AM294612-1|CAL26610.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AM294611-1|CAL26609.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AM294610-1|CAL26608.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHR---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AM294609-1|CAL26607.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AE014296-3162|AAF49153.1| 204|Drosophila melanogaster CG9283-PA protein. Length = 204 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/78 (44%), Positives = 43/78 (55%) Frame = +2 Query: 269 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 448 H+ VQ Q APV H + + S H E KYEF+Y V+D TGD K Q E Sbjct: 63 HSWGTVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWE 119 Query: 449 TRDGDVVKGEYSLLQPDG 502 TRDGD VKG Y++ + DG Sbjct: 120 TRDGDKVKGGYTMKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AE014134-486|AAF51198.2| 302|Drosophila melanogaster CG2973-PA protein. Length = 302 Score = 61.7 bits (143), Expect = 9e-10 Identities = 34/87 (39%), Positives = 44/87 (50%) Frame = +2 Query: 242 RPRGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 421 R NS + ++ Q VQH + +H + E PA Y F+Y+V D Sbjct: 109 RHEQNSEVVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEP-EVFPPASYSFNYAVNDAS 167 Query: 422 TGDHKSQHETRDGDVVKGEYSLLQPDG 502 TGD K ETRDG VV+G YSL+ PDG Sbjct: 168 TGDIKEHSETRDGYVVRGFYSLIDPDG 194 >BT011451-1|AAR99109.1| 340|Drosophila melanogaster RE37955p protein. Length = 340 Score = 61.3 bits (142), Expect = 1e-09 Identities = 39/79 (49%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Frame = +2 Query: 272 ASPVVQHFS--PVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQH 445 A+PVV+ + PV APVV A AV VE + +Y+FSY V D TGD KSQ Sbjct: 96 AAPVVKTLAAAPVVAAPVVKTVAAAPAV--LKQVELESSPRYDFSYGVHDSITGDIKSQV 153 Query: 446 ETRDGDVVKGEYSLLQPDG 502 ETRDG V G YS+L DG Sbjct: 154 ETRDGGNVVGSYSVLDADG 172 >AY070676-1|AAL48147.1| 221|Drosophila melanogaster RH13984p protein. Length = 221 Score = 61.3 bits (142), Expect = 1e-09 Identities = 33/79 (41%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Frame = +2 Query: 272 ASPVVQHFSPV--QHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQH 445 A+P V H +P +A A + V+ ++ + H +Y FSY V+D TGD+K Q Sbjct: 23 AAPQVYHAAPAVATYAHATVAVAQKVVVKAAEEYDPHP--QYRFSYGVDDKLTGDNKGQV 80 Query: 446 ETRDGDVVKGEYSLLQPDG 502 E R GDVV+GEYSL+ DG Sbjct: 81 EERGGDVVRGEYSLIDADG 99 >AE014134-1758|AAN10718.1| 340|Drosophila melanogaster CG33302-PA protein. Length = 340 Score = 61.3 bits (142), Expect = 1e-09 Identities = 39/79 (49%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Frame = +2 Query: 272 ASPVVQHFS--PVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQH 445 A+PVV+ + PV APVV A AV VE + +Y+FSY V D TGD KSQ Sbjct: 96 AAPVVKTLAAAPVVAAPVVKTVAAAPAV--LKQVELESSPRYDFSYGVHDSITGDIKSQV 153 Query: 446 ETRDGDVVKGEYSLLQPDG 502 ETRDG V G YS+L DG Sbjct: 154 ETRDGGNVVGSYSVLDADG 172 >Y18453-1|CAA77177.1| 472|Drosophila melanogaster drosocrystallin protein. Length = 472 Score = 59.3 bits (137), Expect = 5e-09 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 386 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 505 +Y F+Y V D TGD K Q E RDGD+VKG+YSL++PDG+ Sbjct: 76 QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGT 115 >M71249-1|AAA28501.1| 188|Drosophila melanogaster cuticle protein protein. Length = 188 Score = 59.3 bits (137), Expect = 5e-09 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = +2 Query: 335 IPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 +P S+ D P +Y F+Y V+DP TGD KSQ E+RDGDVV G+YS+ DG Sbjct: 20 LPAKSSGSEDTYDSHP-QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADG 74 >AY119178-1|AAM51038.1| 477|Drosophila melanogaster RH66281p protein. Length = 477 Score = 59.3 bits (137), Expect = 5e-09 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 386 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 505 +Y F+Y V D TGD K Q E RDGD+VKG+YSL++PDG+ Sbjct: 76 QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGT 115 >AM294614-1|CAL26612.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 59.3 bits (137), Expect = 5e-09 Identities = 32/66 (48%), Positives = 39/66 (59%) Frame = +2 Query: 305 QHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYS 484 Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDGD VKG Y+ Sbjct: 75 QWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYT 131 Query: 485 LLQPDG 502 + + DG Sbjct: 132 MKEADG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 513 VEYTADHHNGFNAIV 557 VEYTAD HNGF A V Sbjct: 142 VEYTADSHNGFQATV 156 >AE014297-496|AAF54097.2| 188|Drosophila melanogaster CG2345-PA protein. Length = 188 Score = 59.3 bits (137), Expect = 5e-09 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = +2 Query: 335 IPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 +P S+ D P +Y F+Y V+DP TGD KSQ E+RDGDVV G+YS+ DG Sbjct: 20 LPAKSSGSEDTYDSHP-QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADG 74 >AE014134-2114|AAF53134.2| 477|Drosophila melanogaster CG16963-PA protein. Length = 477 Score = 59.3 bits (137), Expect = 5e-09 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 386 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 505 +Y F+Y V D TGD K Q E RDGD+VKG+YSL++PDG+ Sbjct: 76 QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGT 115 >AE001572-20|AAD19810.1| 188|Drosophila melanogaster pupal-cuticle-protein protein. Length = 188 Score = 59.3 bits (137), Expect = 5e-09 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = +2 Query: 335 IPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 +P S+ D P +Y F+Y V+DP TGD KSQ E+RDGDVV G+YS+ DG Sbjct: 20 LPAKSSGSEDTYDSHP-QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADG 74 >AE014134-1650|AAF52783.2| 153|Drosophila melanogaster CG3818-PA protein. Length = 153 Score = 58.8 bits (136), Expect = 6e-09 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +2 Query: 371 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 D+ P YEF +SV DPHTGD KSQ E+R D V+G Y L+ DG Sbjct: 27 DYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDG 70 >AE014134-1730|AAN10712.1| 146|Drosophila melanogaster CG31878-PA, isoform A protein. Length = 146 Score = 58.4 bits (135), Expect = 8e-09 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +2 Query: 341 IAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 I H D + +PA+YEF YSV D H+GD K Q E R G+ V G YSL+ PDG Sbjct: 67 IIASHPDELIA-SPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDG 119 >AE014134-1729|AAN10711.1| 106|Drosophila melanogaster CG31878-PB, isoform B protein. Length = 106 Score = 58.4 bits (135), Expect = 8e-09 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +2 Query: 341 IAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 I H D + +PA+YEF YSV D H+GD K Q E R G+ V G YSL+ PDG Sbjct: 27 IIASHPDELIA-SPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDG 79 >AY070633-1|AAL48104.1| 192|Drosophila melanogaster RH01578p protein. Length = 192 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/64 (43%), Positives = 37/64 (57%) Frame = +2 Query: 314 PVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQ 493 P + A P+ + + +Y FSY V D TGD KSQ ETR GDVV+G YSL++ Sbjct: 35 PALAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIE 94 Query: 494 PDGS 505 DG+ Sbjct: 95 ADGT 98 >AE014297-501|AAF54092.1| 217|Drosophila melanogaster CG1327-PA protein. Length = 217 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 H + +D P KY F+Y V+D +GD KSQ E+RDGDVV+GEYSL DG Sbjct: 54 HEVYPDDPHP-KYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADG 102 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +3 Query: 513 VEYTADHHNGFNAIVH 560 V+YTAD NGFNA+VH Sbjct: 107 VKYTADSVNGFNAVVH 122 >AE014296-792|AAF47861.1| 192|Drosophila melanogaster CG15006-PA protein. Length = 192 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/64 (43%), Positives = 37/64 (57%) Frame = +2 Query: 314 PVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQ 493 P + A P+ + + +Y FSY V D TGD KSQ ETR GDVV+G YSL++ Sbjct: 35 PALAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIE 94 Query: 494 PDGS 505 DG+ Sbjct: 95 ADGT 98 >AE001572-15|AAD19805.1| 217|Drosophila melanogaster cuticle protein protein. Length = 217 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 H + +D P KY F+Y V+D +GD KSQ E+RDGDVV+GEYSL DG Sbjct: 54 HEVYPDDPHP-KYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADG 102 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +3 Query: 513 VEYTADHHNGFNAIVH 560 V+YTAD NGFNA+VH Sbjct: 107 VKYTADSVNGFNAVVH 122 >AY070951-1|AAL48573.1| 208|Drosophila melanogaster RE04882p protein. Length = 208 Score = 57.2 bits (132), Expect = 2e-08 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +2 Query: 311 APV-VHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSL 487 APV V A +P+ + + E +Y +SY V+D +GD+K E RDGDVV+GEYSL Sbjct: 24 APVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSL 83 Query: 488 LQPDG 502 + DG Sbjct: 84 IDADG 88 >AE014297-499|AAF54094.1| 208|Drosophila melanogaster CG1330-PA protein. Length = 208 Score = 57.2 bits (132), Expect = 2e-08 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +2 Query: 311 APV-VHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSL 487 APV V A +P+ + + E +Y +SY V+D +GD+K E RDGDVV+GEYSL Sbjct: 24 APVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSL 83 Query: 488 LQPDG 502 + DG Sbjct: 84 IDADG 88 >AE001572-17|AAD19807.1| 208|Drosophila melanogaster cuticle protein protein. Length = 208 Score = 57.2 bits (132), Expect = 2e-08 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +2 Query: 311 APV-VHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSL 487 APV V A +P+ + + E +Y +SY V+D +GD+K E RDGDVV+GEYSL Sbjct: 24 APVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSL 83 Query: 488 LQPDG 502 + DG Sbjct: 84 IDADG 88 >AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA protein. Length = 218 Score = 55.2 bits (127), Expect = 8e-08 Identities = 25/50 (50%), Positives = 31/50 (62%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 H DH + HA +Y+F Y V+D TGD KSQ E+R G V G Y L+ DG Sbjct: 62 HDDHHDSHA--EYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADG 109 >AY121656-1|AAM51983.1| 206|Drosophila melanogaster RE04513p protein. Length = 206 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +2 Query: 329 AAIPIAVEHSDHVEDHAP-AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 AA P+A VE++ P +Y + Y V+D +GD K+Q ETR+GDVV+G+YSL DG Sbjct: 38 AAAPLAAVAQ--VEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADG 94 >AE014297-497|AAF54096.1| 191|Drosophila melanogaster CG2342-PA protein. Length = 191 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +2 Query: 329 AAIPIAVEHSDHVEDHAP-AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 AA P+A VE++ P +Y + Y V+D +GD K+Q ETR+GDVV+G+YSL DG Sbjct: 23 AAAPLAAVAQ--VEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADG 79 >AE001572-19|AAD19809.1| 191|Drosophila melanogaster cuticle protein protein. Length = 191 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +2 Query: 329 AAIPIAVEHSDHVEDHAP-AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 AA P+A VE++ P +Y + Y V+D +GD K+Q ETR+GDVV+G+YSL DG Sbjct: 23 AAAPLAAVAQ--VEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADG 79 >AY071231-1|AAL48853.1| 217|Drosophila melanogaster RE26879p protein. Length = 217 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/45 (48%), Positives = 29/45 (64%) Frame = +2 Query: 368 EDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 E + PAKYEF Y V+D +G+ E+RDGD+ G Y +L PDG Sbjct: 121 EQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDG 165 >AE013599-2993|AAF57484.2| 217|Drosophila melanogaster CG9036-PA protein. Length = 217 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/45 (48%), Positives = 29/45 (64%) Frame = +2 Query: 368 EDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 E + PAKYEF Y V+D +G+ E+RDGD+ G Y +L PDG Sbjct: 121 EQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDG 165 >AE013599-2342|AAF57953.1| 620|Drosophila melanogaster CG15920-PA, isoform A protein. Length = 620 Score = 50.8 bits (116), Expect = 2e-06 Identities = 22/45 (48%), Positives = 29/45 (64%) Frame = +2 Query: 368 EDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 ++ PAKYEF+Y VED +G E RDGD G+Y++L PDG Sbjct: 338 DNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDG 382 >AY060758-1|AAL28306.1| 178|Drosophila melanogaster GH20904p protein. Length = 178 Score = 49.2 bits (112), Expect = 5e-06 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +2 Query: 359 DHVEDHAPAK-YEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 DHV H P Y+F Y+V+DP T + + + DGDVV GEY + PDG Sbjct: 81 DHV--HVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDG 127 >AE013599-1764|AAF58336.1| 178|Drosophila melanogaster CG6305-PA protein. Length = 178 Score = 49.2 bits (112), Expect = 5e-06 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +2 Query: 359 DHVEDHAPAK-YEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDG 502 DHV H P Y+F Y+V+DP T + + + DGDVV GEY + PDG Sbjct: 81 DHV--HVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDG 127 >BT024343-1|ABC86405.1| 266|Drosophila melanogaster IP09562p protein. Length = 266 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +2 Query: 353 HSDHVEDH-APAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 H D+ A +Y F+Y VED T +++ ETR+GD V+G YS++ PDG++ Sbjct: 90 HDGRTVDYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTL 142 >AE014296-1421|AAF50444.1| 266|Drosophila melanogaster CG13670-PA protein. Length = 266 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +2 Query: 353 HSDHVEDH-APAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 H D+ A +Y F+Y VED T +++ ETR+GD V+G YS++ PDG++ Sbjct: 90 HDGRTVDYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTL 142 >AY071527-1|AAL49149.1| 270|Drosophila melanogaster RE57183p protein. Length = 270 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/53 (32%), Positives = 32/53 (60%) Frame = +2 Query: 350 EHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 ++ + D + Y+F + V+D +++++ E RDG V+KG YS++ DG I Sbjct: 145 QNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFI 197 >AY071448-1|AAL49070.1| 815|Drosophila melanogaster RE53044p protein. Length = 815 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +2 Query: 383 AKYEFSYSVEDPHTGDHKSQHETRD-GDVVKGEYSLLQPDGSIASRIH 523 +KYEF Y + D HTG+ + RD V +G+Y +L PDG I + I+ Sbjct: 749 SKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIY 796 >AE014296-1500|AAF50383.2| 270|Drosophila melanogaster CG32029-PA protein. Length = 270 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/53 (32%), Positives = 32/53 (60%) Frame = +2 Query: 350 EHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 508 ++ + D + Y+F + V+D +++++ E RDG V+KG YS++ DG I Sbjct: 145 QNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFI 197 >AE013599-1762|AAF58339.2| 815|Drosophila melanogaster CG13338-PA protein. Length = 815 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +2 Query: 383 AKYEFSYSVEDPHTGDHKSQHETRD-GDVVKGEYSLLQPDGSIASRIH 523 +KYEF Y + D HTG+ + RD V +G+Y +L PDG I + I+ Sbjct: 749 SKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIY 796 >AM294624-1|CAL26622.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 3/78 (3%) Frame = +2 Query: 290 HFSPVQHAPVVHHAAIPIAVE-HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDG 460 H + QH P H +E +SD+ +H + +S Y + D + H E R+G Sbjct: 23 HIAHTQHGPAGH-------IEFYSDYGRNHDEERLHYSHQYHISDVASRVHILHQEQRNG 75 Query: 461 DVVKGEYSLLQPDGSIAS 514 D V G YS L+P G I S Sbjct: 76 DYVSGSYSHLEPSGHIRS 93 >AM294629-1|CAL26627.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G I S Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRNGDYVSGSYSHLEPSGHIRS 93 >AM294628-1|CAL26626.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G I S Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRNGDYVSGSYSHLEPSGHIRS 93 >AM294627-1|CAL26625.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G I S Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHQEQRNGDYVSGSYSHLEPSGHIRS 93 >AM294626-1|CAL26624.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G I S Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHQEQRNGDYVSGSYSHLEPSGHIRS 93 >AM294623-1|CAL26621.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G I S Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRNGDYVSGSYSHLEPSGHIRS 93 >AM294621-1|CAL26619.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G I S Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRNGDYVSGSYSHLEPSGHIRS 93 >AY071564-1|AAL49186.1| 124|Drosophila melanogaster RE63063p protein. Length = 124 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/46 (47%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = +3 Query: 117 IVRHDEPSHQATA-HYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPV 251 IV+ SH A A H PV+ H+ PV+ HAAP++ H+ P+VH+AP+ Sbjct: 66 IVKTTTYSHPAVAVHAAPVV-HSVPVV-HAAPVV-HSVPLVHSAPL 108 Score = 35.1 bits (77), Expect = 0.088 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = +3 Query: 99 AVSSQSIVR-HDEPSHQ---ATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPV 251 AVS QSI + H + Q A T SH A V HAAP++ H+ P+VHAAPV Sbjct: 44 AVSHQSITQVHSKAVVQPVVAPIVKTTTYSHPA-VAVHAAPVV-HSVPVVHAAPV 96 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +3 Query: 135 PSHQATAHYTPVLS-HAAPVLTHAAPLIQHAGPIVHAAPV 251 P + T + P ++ HAAPV+ H+ P++ HA P+VH+ P+ Sbjct: 65 PIVKTTTYSHPAVAVHAAPVV-HSVPVV-HAAPVVHSVPL 102 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 266 IHASPVVQHFSPVQH-APVVHHAAIPIAVEHSDHVEDHAPAKY 391 +HA+PVV H PV H APVVH + + V AP Y Sbjct: 79 VHAAPVV-HSVPVVHAAPVVHSVPLVHSAPLVKSVVHSAPLAY 120 >AE014296-2695|AAF49493.1| 124|Drosophila melanogaster CG13041-PA protein. Length = 124 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/46 (47%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = +3 Query: 117 IVRHDEPSHQATA-HYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPV 251 IV+ SH A A H PV+ H+ PV+ HAAP++ H+ P+VH+AP+ Sbjct: 66 IVKTTTYSHPAVAVHAAPVV-HSVPVV-HAAPVV-HSVPLVHSAPL 108 Score = 35.1 bits (77), Expect = 0.088 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = +3 Query: 99 AVSSQSIVR-HDEPSHQ---ATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPV 251 AVS QSI + H + Q A T SH A V HAAP++ H+ P+VHAAPV Sbjct: 44 AVSHQSITQVHSKAVVQPVVAPIVKTTTYSHPA-VAVHAAPVV-HSVPVVHAAPV 96 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +3 Query: 135 PSHQATAHYTPVLS-HAAPVLTHAAPLIQHAGPIVHAAPV 251 P + T + P ++ HAAPV+ H+ P++ HA P+VH+ P+ Sbjct: 65 PIVKTTTYSHPAVAVHAAPVV-HSVPVV-HAAPVVHSVPL 102 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 266 IHASPVVQHFSPVQH-APVVHHAAIPIAVEHSDHVEDHAPAKY 391 +HA+PVV H PV H APVVH + + V AP Y Sbjct: 79 VHAAPVV-HSVPVVHAAPVVHSVPLVHSAPLVKSVVHSAPLAY 120 >AE014296-369|AAF47578.1| 143|Drosophila melanogaster CG13934-PA protein. Length = 143 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +2 Query: 353 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 +SD+ +H + +S Y + D + H E R GD V G YS L+P G I S Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRS 93 >AM294630-1|CAL26628.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = +2 Query: 371 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 D Y Y + D + H E R+GD V G YS L+P G I S Sbjct: 46 DEERLHYSHQYHISDAASRVHILHREQRNGDYVSGSYSHLEPSGHIRS 93 >AM294625-1|CAL26623.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 36.7 bits (81), Expect = 0.029 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = +2 Query: 371 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 D Y Y + D + H E R+GD V G YS L+P G I S Sbjct: 46 DEERLHYSHQYHISDVASRVHILHQEQRNGDYVSGSYSHLEPSGHIRS 93 >AM294622-1|CAL26620.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 36.7 bits (81), Expect = 0.029 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = +2 Query: 371 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 D Y Y + D + H E R+GD V G YS L+P G I S Sbjct: 46 DEERLHYSHQYHISDVASRVHILHQEQRNGDYVSGSYSHLEPSGHIRS 93 >BT023021-1|AAY55437.1| 133|Drosophila melanogaster IP04071p protein. Length = 133 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +2 Query: 371 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIAS 514 D Y Y + D + H E R GD V G YS L+P G I S Sbjct: 36 DEERLHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRS 83 >AY071377-1|AAL48999.1| 131|Drosophila melanogaster RE40431p protein. Length = 131 Score = 35.1 bits (77), Expect = 0.088 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = +3 Query: 99 AVSSQSIVR-HDEPSHQ---ATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPV 251 AVS QSI + H + Q A T SH A V HAAP++ H+ P+VHAAPV Sbjct: 44 AVSHQSITQVHSKAVVQPVVAPIVKTTTYSHPA-VAVHAAPVV-HSVPVVHAAPV 96 >AE014296-2696|AAF49492.1| 131|Drosophila melanogaster CG13060-PA protein. Length = 131 Score = 35.1 bits (77), Expect = 0.088 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = +3 Query: 99 AVSSQSIVR-HDEPSHQ---ATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPV 251 AVS QSI + H + Q A T SH A V HAAP++ H+ P+VHAAPV Sbjct: 44 AVSHQSITQVHSKAVVQPVVAPIVKTTTYSHPA-VAVHAAPVV-HSVPVVHAAPV 96 >AY084169-1|AAL89907.1| 123|Drosophila melanogaster RE40783p protein. Length = 123 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +3 Query: 21 MFFKIAVVCSILAICQGGVIDE-GHGHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLT 197 MF IA++ ++ A+ GVI HG+ + + + P++ A A V+SHA + + Sbjct: 1 MFKLIALISALCAVANAGVISPYSHGYGLGYGAALA---PAYAAPA----VISHAPIIKS 53 Query: 198 HAAPLIQH 221 +AAP++ H Sbjct: 54 YAAPIVAH 61 >AY070997-1|AAL48619.1| 144|Drosophila melanogaster RE08808p protein. Length = 144 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +2 Query: 383 AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIASRI 520 A+Y F+ SV+D S++E R+G V+G YS DG + R+ Sbjct: 42 AQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRV 85 >AE014296-2686|AAF49501.1| 123|Drosophila melanogaster CG4962-PA protein. Length = 123 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +3 Query: 21 MFFKIAVVCSILAICQGGVIDE-GHGHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLT 197 MF IA++ ++ A+ GVI HG+ + + + P++ A A V+SHA + + Sbjct: 1 MFKLIALISALCAVANAGVISPYSHGYGLGYGAALA---PAYAAPA----VISHAPIIKS 53 Query: 198 HAAPLIQH 221 +AAP++ H Sbjct: 54 YAAPIVAH 61 >AE013599-1904|AAF58238.1| 144|Drosophila melanogaster CG10112-PA protein. Length = 144 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +2 Query: 383 AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIASRI 520 A+Y F+ SV+D S++E R+G V+G YS DG + R+ Sbjct: 42 AQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRV 85 >DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QXAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QXAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QXAPRAEHX------HHHDHDXDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QXAPRAEHX------HHHDHDXDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHX------HHHDHDXDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHP------HHHDHDXDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QXAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDRDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 >DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 248 RGNSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTG 427 +GN S+ ++ ++F P Q AP H H DH DH + + + H Sbjct: 39 QGNPSFKYSREANENFDP-QKAPRAEHH------HHHDHDHDHGHHHHGHDHDHDHDHGH 91 Query: 428 DHKSQHETRDGD 463 DH H D D Sbjct: 92 DHGHHHHGHDHD 103 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,564,011 Number of Sequences: 53049 Number of extensions: 792667 Number of successful extensions: 3844 Number of sequences better than 10.0: 308 Number of HSP's better than 10.0 without gapping: 3142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3801 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2910007350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -