BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30318 (468 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 23 1.1 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 23 1.1 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 23 1.1 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 1.9 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 128 LERAFTRVINFVRKKMRLLFYARGIMLQYIY 220 L + F + +N + RL FY G+ Y+Y Sbjct: 90 LHKIFAKGLNVIEAN-RLFFYCSGLASGYLY 119 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 128 LERAFTRVINFVRKKMRLLFYARGIMLQYIY 220 L + F + +N + RL FY G+ Y+Y Sbjct: 90 LHKIFAKGLNVIEAN-RLFFYCSGLASGYLY 119 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 128 LERAFTRVINFVRKKMRLLFYARGIMLQYIY 220 L + F + +N + RL FY G+ Y+Y Sbjct: 90 LHKIFAKGLNVIEAN-RLFFYCSGLASGYLY 119 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.6 bits (46), Expect = 1.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 3 GDGQMKCDPKACTPEPMLRQMI 68 G G ++ DP +C P LRQ I Sbjct: 39 GGGAVQPDPGSCDPSVGLRQGI 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,026 Number of Sequences: 336 Number of extensions: 2109 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10826639 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -