BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30318 (468 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.08 |||mitochondrial ribosomal small subunit|Schizosaccharo... 26 2.5 SPBC9B6.09c |mdl1||mitochondrial peptide-transporting ATPase|Sch... 26 3.3 >SPMIT.08 |||mitochondrial ribosomal small subunit|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 227 Score = 26.2 bits (55), Expect = 2.5 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 141 KALSRQLVKRRKMFIFVV*LKQLPLSFVLASAL 43 KALS L+ K + F+V ++ LP+S S+L Sbjct: 81 KALSNHLLYSSKNYSFIVNIRALPISTPYGSSL 113 >SPBC9B6.09c |mdl1||mitochondrial peptide-transporting ATPase|Schizosaccharomyces pombe|chr 2|||Manual Length = 726 Score = 25.8 bits (54), Expect = 3.3 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 5 RRSNEMRSKSVHSRADAKTNDSGSCFS*TTKMNIFRRFT 121 R ++ + SK ++ +K N +G+ + K+N+FR FT Sbjct: 111 RHNSTVPSKDEQAQDISKINTNGTLQTPNKKVNVFRLFT 149 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,748,909 Number of Sequences: 5004 Number of extensions: 33446 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -