BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30318 (468 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 25 1.00 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 7.0 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 25.4 bits (53), Expect = 1.00 Identities = 22/67 (32%), Positives = 30/67 (44%) Frame = -2 Query: 326 TVMIDHI*SAMSPESVTVYF*LINLMTRNLKLLHRDKCIGALFHVHRRVDAFFFSQSLLP 147 TVM+D A+S E + + + L + RDK I AL H+ F +S LP Sbjct: 167 TVMLDM--EAVSLEQIAELVCENMVNSGTLPVEARDKVIDALLKRHKHQHEFGSKKSRLP 224 Query: 146 L*RLFRD 126 L R D Sbjct: 225 LIRSLAD 231 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 22.6 bits (46), Expect = 7.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 97 DEHFSTFYQLSRKSLH 144 DEH FY+L +K H Sbjct: 449 DEHNKNFYELKKKKDH 464 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 433,389 Number of Sequences: 2352 Number of extensions: 8206 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -