Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30318
         (468 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC006406-1|AAH06406.2|  115|Homo sapiens FAM104B protein protein.      31   2.6  

>BC006406-1|AAH06406.2|  115|Homo sapiens FAM104B protein protein.
          Length = 115

 Score = 30.7 bits (66), Expect = 2.6
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = -3

Query: 169 FSHKVYYPCEGSFETIGKTSKNVHLRRLAETAAA 68
           F H+ Y PC+G +  I +T K  H   L +   A
Sbjct: 80  FLHEGYVPCQGLYSHINQTLKEAHFNSLQQRGQA 113


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 56,882,088
Number of Sequences: 237096
Number of extensions: 1050084
Number of successful extensions: 5194
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5159
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5194
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 4042952858
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)