BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30317 (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28470.1 68417.m04073 26S proteasome regulatory subunit, puta... 27 9.9 At1g77990.1 68414.m09088 sulfate transporter identical to sulfat... 27 9.9 >At4g28470.1 68417.m04073 26S proteasome regulatory subunit, putative contains Pfam domain PF01851: Proteasome/cyclosome repeat Length = 1103 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 598 RNLDHFYYK*INLFYRFKISHFSLFLHDVTNVNLVSRKYKVII 726 RNL +YYK +L + F L H + V+ R +++ Sbjct: 800 RNLSSYYYKDASLLFCVTFYDFFLSFHGINTVSTYDRLVLIVL 842 >At1g77990.1 68414.m09088 sulfate transporter identical to sulfate transporter [Arabidopsis thaliana] GI:1498120 Length = 658 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 566 VN*ASQVRKIAGILTIFITSKLICFTDLRLV 658 +N K AG+LT+ I+S L+CF + + Sbjct: 518 INQYPMANKTAGLLTLRISSPLLCFANANFI 548 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,407,044 Number of Sequences: 28952 Number of extensions: 239071 Number of successful extensions: 475 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -