BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30316 (727 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 26 1.4 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 3.2 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 24 4.2 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 5.5 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 23 7.3 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 23 7.3 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 7.3 AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-tran... 23 7.3 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 25.8 bits (54), Expect = 1.4 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = +2 Query: 521 FIKFESGNLCMITGGRNLGLLGTIVSRERKSRFLRHCAHQGFHGKNLGHEVNKRVHN 691 F+ +SGN M+ R + +LG +V E S + H N+GH V VH+ Sbjct: 324 FVLDKSGNRIMLDEQRGIDILGDVV--EASSLTPNAQLYGSLH--NMGHNVIAYVHD 376 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 580 FGHHRVPREKIPVPSTLCTSRIPREKPWPRG 672 FGH P E + C +PR+ P +G Sbjct: 253 FGHVATPEELTQAITVACDGTMPRQPPRRQG 283 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 24.2 bits (50), Expect = 4.2 Identities = 19/74 (25%), Positives = 32/74 (43%) Frame = +1 Query: 28 EAFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCFDRKRILKIVK 207 E F+AL+++ +G + VC T+ S +A F SS+ F+ R + V Sbjct: 337 ECFDALRKADIYAIGLIFWEVCRRTI--SCGIAEEYKVPYFDYVSSDPSFEEMRKVVCVD 394 Query: 208 QRLIKVDGKVRTDP 249 V + +DP Sbjct: 395 NYRPSVQNRWTSDP 408 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +1 Query: 31 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 177 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +1 Query: 31 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 177 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +1 Query: 31 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 177 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 29 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 452 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 363 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-transferase D3 protein. Length = 210 Score = 23.4 bits (48), Expect = 7.3 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 597 DTMVPKSPKLRPPVIIHKFPD-SNLMKSII 511 DT+ PK PK+R V F D L K II Sbjct: 79 DTLYPKDPKVRSVVNQRLFFDIGTLYKQII 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 876,095 Number of Sequences: 2352 Number of extensions: 19398 Number of successful extensions: 87 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -