BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30316 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 27 0.18 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 0.73 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.2 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.1 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 9.0 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.18 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -3 Query: 365 SLLRGDTVDCESALNIID*TKQFISLLN*DNIH 267 SLL+ +TV C+ A++++ + +++ DNIH Sbjct: 381 SLLKENTVTCQEAMHMLKNADSQLLVISDDNIH 413 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 25.0 bits (52), Expect = 0.73 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 635 HQGFHGKNLGHEVNKRVHNRQGPKGV 712 H G G +GH N H+R G + + Sbjct: 1755 HSGTMGPPVGHPTNASAHSRSGSQSM 1780 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.4 bits (48), Expect = 2.2 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = -3 Query: 476 DFDKWVWIADGAAIMRYQVRNILRSGRHTLDFTQLVLSLLRGDTVDCESALNIID*TKQF 297 D +WI G +M + + R G+ + T L+ ++L + CE +NI K + Sbjct: 57 DVHVMIWIGFGF-LMTF----LRRYGQSAVGLTFLLGAILVQVAIICEGVMNIQKDNKSY 111 Query: 296 ISL 288 +SL Sbjct: 112 LSL 114 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 5.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 171 YFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLS 70 Y R +R T +H ++ +DG+G Y S S Sbjct: 83 YNRMDMRNATYYQHQQDHGSGMDGMGGYRSASPS 116 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 49 RSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPE 156 +S++ DV ++WR + E NR+ R++ + E Sbjct: 261 QSETYDVLRSWRNLMDEHSNRTNSDPRMILTEAYTE 296 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,367 Number of Sequences: 438 Number of extensions: 5512 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -