BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30314 (703 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeo... 25 2.3 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 24 5.3 >AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeotic protein protein. Length = 324 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 593 GTVLLTRGKRPLPQLGHH-GPGTFPIPE 673 GT G PL Q+GHH G IP+ Sbjct: 135 GTYGTENGSPPLDQMGHHMGTAQMTIPQ 162 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 23.8 bits (49), Expect = 5.3 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +2 Query: 569 AIKSFAVPGTV-LLTRGKRPLPQLG--HHGPGTFPIPEALE 682 A K + VPGT +L G + + HH P FP PE + Sbjct: 377 ASKDYHVPGTKSVLEAGTAVMIPVHAIHHDPEVFPNPEQFD 417 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 704,610 Number of Sequences: 2352 Number of extensions: 14648 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -