BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30311 (494 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0429 - 10135695-10135769,10135872-10135972,10138416-101385... 30 0.89 12_01_0329 + 2545511-2546683,2546983-2546993,2547377-2547438,254... 27 8.3 >02_02_0429 - 10135695-10135769,10135872-10135972,10138416-10138532, 10138810-10139041,10142326-10142442,10142762-10142827 Length = 235 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 36 ILKNNSIRNILCIGTPTVHEAAQTHPDFNSILLDYDK 146 +LK + I+N++ +G T + QT F+++ LDYDK Sbjct: 126 VLKTSGIKNLVIVGVQTPNCIRQT--VFDAVALDYDK 160 >12_01_0329 + 2545511-2546683,2546983-2546993,2547377-2547438, 2547882-2548225 Length = 529 Score = 27.1 bits (57), Expect = 8.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 422 YITNMLPEIKMHDYQVEYE 478 Y TN E+ +HDY+ EY+ Sbjct: 348 YHTNQKKELDLHDYEAEYD 366 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,161,424 Number of Sequences: 37544 Number of extensions: 247395 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1035514020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -