BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30309 (815 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 25 0.84 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 25 0.84 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 5.9 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 7.8 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 25.0 bits (52), Expect = 0.84 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Frame = +1 Query: 211 ECRRCP-----TVIMACHFLIEQKTE---GSERKQQMAKEYRVKVEKELREICYDV 354 +C++C + FL+E K E K K+YRVK E+E +++ +V Sbjct: 75 DCKKCTDKQREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEEEAKKLGINV 130 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 25.0 bits (52), Expect = 0.84 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Frame = +1 Query: 211 ECRRCP-----TVIMACHFLIEQKTE---GSERKQQMAKEYRVKVEKELREICYDV 354 +C++C + FL+E K E K K+YRVK E+E +++ +V Sbjct: 75 DCKKCTDKQREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEEEAKKLGINV 130 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 5.9 Identities = 13/63 (20%), Positives = 32/63 (50%) Frame = +1 Query: 259 EQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFYLKMKGDY 438 E++T +E+ +M K Y ++KE +++ ++ + + A ++ + K K D+ Sbjct: 441 EKRTIENEQLNRMYKSYPNYIDKETKDMNLEISTRPKSNTVENACVLKNTEIF-KDKSDW 499 Query: 439 YRY 447 + Y Sbjct: 500 FDY 502 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = -2 Query: 226 GTYDILISN*KEVPLXVAXFDAGFRHFLHRGRHV 125 G +D+ + + + V A F HRG H+ Sbjct: 183 GAFDVTLESGERVTFLDTPGHAAFISMRHRGAHI 216 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,160 Number of Sequences: 438 Number of extensions: 4276 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -