BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30300 (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 56 1e-09 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 56 1e-09 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 56 1e-09 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 56 1e-09 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 6e-08 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 0.48 AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N p... 24 4.6 AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N p... 24 6.0 AY341149-1|AAR13713.1| 164|Anopheles gambiae aminopeptidase N p... 24 6.0 AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N p... 24 6.0 AY341147-1|AAR13711.1| 164|Anopheles gambiae aminopeptidase N p... 24 6.0 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 8.0 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 56.0 bits (129), Expect = 1e-09 Identities = 23/61 (37%), Positives = 40/61 (65%) Frame = +2 Query: 494 LIDGALSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYD 673 L+ + +Y + +++ P+P+VS VVEPYN+ L+ H +E++D + +DNEA+YD Sbjct: 46 LLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYD 105 Query: 674 I 676 I Sbjct: 106 I 106 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 360 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 458 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 56.0 bits (129), Expect = 1e-09 Identities = 23/61 (37%), Positives = 40/61 (65%) Frame = +2 Query: 494 LIDGALSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYD 673 L+ + +Y + +++ P+P+VS VVEPYN+ L+ H +E++D + +DNEA+YD Sbjct: 46 LLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYD 105 Query: 674 I 676 I Sbjct: 106 I 106 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 360 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 458 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 56.0 bits (129), Expect = 1e-09 Identities = 23/61 (37%), Positives = 40/61 (65%) Frame = +2 Query: 494 LIDGALSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYD 673 L+ + +Y + +++ P+P+VS VVEPYN+ L+ H +E++D + +DNEA+YD Sbjct: 46 LLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYD 105 Query: 674 I 676 I Sbjct: 106 I 106 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 360 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 458 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 56.0 bits (129), Expect = 1e-09 Identities = 23/61 (37%), Positives = 40/61 (65%) Frame = +2 Query: 494 LIDGALSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYD 673 L+ + +Y + +++ P+P+VS VVEPYN+ L+ H +E++D + +DNEA+YD Sbjct: 46 LLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYD 105 Query: 674 I 676 I Sbjct: 106 I 106 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 360 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 458 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 6e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +1 Query: 43 MRECISVHVGQAGVQIGNACWE 108 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 42.7 bits (96), Expect = 1e-05 Identities = 25/51 (49%), Positives = 27/51 (52%) Frame = +2 Query: 98 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELASTYPVLSSSI 250 P T WS AS+ RCP+TR S ST SS R AST PV SSI Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCPVPCSSI 69 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect(2) = 0.48 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 149 CPQTRPSGVETILSTLSSARPELAS 223 C RPS ++ ++ S RP+LA+ Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAA 188 Score = 21.8 bits (44), Expect(2) = 0.48 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 92 VMPAGSFTAWSTASSLMARCPQTRPSGV 175 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 >AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 24.2 bits (50), Expect = 4.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 718 WCRLGRSMSRLRRPDVIDGFIV 653 W G S L + D++DGFIV Sbjct: 96 WMPQGTSQVSLEQGDLLDGFIV 117 >AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 718 WCRLGRSMSRLRRPDVIDGFIV 653 W G S L + D++DGFIV Sbjct: 96 WMPQGTSQVSLEQGDLMDGFIV 117 >AY341149-1|AAR13713.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 718 WCRLGRSMSRLRRPDVIDGFIV 653 W G S L + D++DGFIV Sbjct: 96 WMPQGTSQVSLEQGDLMDGFIV 117 >AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 718 WCRLGRSMSRLRRPDVIDGFIV 653 W G S L + D++DGFIV Sbjct: 96 WMPQGTSQVSLEQGDLMDGFIV 117 >AY341147-1|AAR13711.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 718 WCRLGRSMSRLRRPDVIDGFIV 653 W G S L + D++DGFIV Sbjct: 96 WMPQGTSQVSLEQGDLMDGFIV 117 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.4 bits (48), Expect = 8.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 171 GWRRFFQHFLQRDRSWQARTPCCLRRS*P 257 GW + HF QR R W R L S P Sbjct: 12 GWLWIYLHFNQRYRFWVERQVPFLEPSFP 40 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 864,017 Number of Sequences: 2352 Number of extensions: 18310 Number of successful extensions: 60 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -