BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30299 (707 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 28 0.065 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 24 1.4 L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protei... 23 2.4 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 23 3.2 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 21 9.8 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 9.8 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 28.3 bits (60), Expect = 0.065 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -3 Query: 612 HLLSHQHNRLHQLHICF*SHYRHGVCPSRLHTPQESGHKEVRL 484 HL+ H+ N H+L F H H + LH + + H+EV+L Sbjct: 87 HLMIHRPNWWHELETKFNPH--HEIKLQHLHQSKFNPHEEVKL 127 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 23.8 bits (49), Expect = 1.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 215 LSLNGLKKYQYVIKLWWGY 159 L+ LK+Y +KLWW + Sbjct: 45 LAKGSLKQYTCELKLWWEF 63 >L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protein protein. Length = 46 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 371 TSSPPCKTTICP 336 T + PCK TICP Sbjct: 3 THTLPCKCTICP 14 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.6 bits (46), Expect = 3.2 Identities = 6/20 (30%), Positives = 11/20 (55%) Frame = +3 Query: 216 NCLSLYHRTWQRRVYGPWHS 275 +C + + W +R Y W+S Sbjct: 189 DCWATFQEPWGKRAYVTWYS 208 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.0 bits (42), Expect = 9.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -3 Query: 525 LHTPQESGHKEVRLACTNI 469 L PQ H+EV+ C+++ Sbjct: 262 LVNPQSLNHQEVKAECSDL 280 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 9.8 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = -2 Query: 391 HQYHSGSHLH 362 H +H+G H+H Sbjct: 322 HHHHAGHHIH 331 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,161 Number of Sequences: 336 Number of extensions: 4424 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -