BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30296 (509 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 3.7 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 8.4 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 8.4 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 21 8.4 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 21 8.4 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/28 (39%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = -3 Query: 450 QQQNNETKTTKI---HIHEXLYAHAKHN 376 QQQNN T H H + HA+H+ Sbjct: 308 QQQNNNNAATNNQNHHHHAGHHIHAQHH 335 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 20.6 bits (41), Expect = 8.4 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -3 Query: 462 LIQRQQQNNETKTTKIHIHEXLYAHAKHNARARE 361 L+ R N + IH+ Y ++ ARARE Sbjct: 131 LLHRPDTQNLDLPSFIHVFPDKYVDSQVFARARE 164 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 20.6 bits (41), Expect = 8.4 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 500 SFAPSSSSILNND*YNVNNR 441 S +PSS++++ N+ N N+R Sbjct: 331 SNSPSSTNLIQNEASNENSR 350 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 20.6 bits (41), Expect = 8.4 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 500 SFAPSSSSILNND*YNVNNR 441 S +PSS++++ N+ N N+R Sbjct: 120 SNSPSSTNLIQNEASNENSR 139 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 20.6 bits (41), Expect = 8.4 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 500 SFAPSSSSILNND*YNVNNR 441 S +PSS++++ N+ N N+R Sbjct: 120 SNSPSSTNLIQNEASNENSR 139 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,855 Number of Sequences: 336 Number of extensions: 1818 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12154132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -