BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30296 (509 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75527-4|CAA99779.2| 316|Caenorhabditis elegans Hypothetical pr... 28 3.4 DQ178236-1|ABA18178.1| 316|Caenorhabditis elegans putative low ... 28 3.4 AC024763-9|AAU20836.1| 404|Caenorhabditis elegans Hypothetical ... 28 3.4 AC024763-8|AAK93863.1| 480|Caenorhabditis elegans Hypothetical ... 28 3.4 U42839-7|AAC69012.1| 1722|Caenorhabditis elegans Drosophila crum... 27 6.0 AF022982-3|AAB69932.1| 670|Caenorhabditis elegans Hypothetical ... 27 6.0 >Z75527-4|CAA99779.2| 316|Caenorhabditis elegans Hypothetical protein C15C8.4 protein. Length = 316 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -3 Query: 435 ETKTTKIHIHEXLYAHAKHNA--RAREVRRDYENFEITIKHF*IRRR 301 E++ KI H+ + + +A R ++ + YEN E++IKH + R+ Sbjct: 252 ESQLKKIEFHKEEVSRLQEDAEERGKDKSQVYENLELSIKHEKLNRK 298 >DQ178236-1|ABA18178.1| 316|Caenorhabditis elegans putative low density lipoproteinreceptor associated protein (37.4 kD) protein. Length = 316 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -3 Query: 435 ETKTTKIHIHEXLYAHAKHNA--RAREVRRDYENFEITIKHF*IRRR 301 E++ KI H+ + + +A R ++ + YEN E++IKH + R+ Sbjct: 252 ESQLKKIEFHKEEVSRLQEDAEERGKDKSQVYENLELSIKHEKLNRK 298 >AC024763-9|AAU20836.1| 404|Caenorhabditis elegans Hypothetical protein Y39A3CL.7b protein. Length = 404 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -2 Query: 304 ERRASETRFVIVVFGQI*LKKTTRNDEYERVNAERVNATDHER 176 ERR +R + + I K T +D+Y++ A++ N D R Sbjct: 343 ERRRDRSRSRSLTYSPIDRKSRTNSDKYDKKRAKKSNRRDRSR 385 >AC024763-8|AAK93863.1| 480|Caenorhabditis elegans Hypothetical protein Y39A3CL.7a protein. Length = 480 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -2 Query: 304 ERRASETRFVIVVFGQI*LKKTTRNDEYERVNAERVNATDHER 176 ERR +R + + I K T +D+Y++ A++ N D R Sbjct: 419 ERRRDRSRSRSLTYSPIDRKSRTNSDKYDKKRAKKSNRRDRSR 461 >U42839-7|AAC69012.1| 1722|Caenorhabditis elegans Drosophila crumbs homolog protein 1 protein. Length = 1722 Score = 27.5 bits (58), Expect = 6.0 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = -3 Query: 159 CD*CFLCSRPSD-RSGPGCVSTDRNVRSKC-----RCSNVSCSS 46 C+ C S D SGP C+ D KC +CS VSC S Sbjct: 472 CEDCVNSSNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPS 515 >AF022982-3|AAB69932.1| 670|Caenorhabditis elegans Hypothetical protein T23B12.6 protein. Length = 670 Score = 27.5 bits (58), Expect = 6.0 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 167 PRNVINVF-YAAGPQTGVVLDVSPRTAMCVRNVDVQMCPA 51 PR++IN+ Y+ GP +LDV +C + CP+ Sbjct: 627 PRSLINLSNYSGGPTPQELLDVIDDNDICCSTPSLSRCPS 666 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,843,639 Number of Sequences: 27780 Number of extensions: 178715 Number of successful extensions: 470 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -