Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30292
         (756 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE006467-9|AAK61283.1|  473|Homo sapiens similar to portion of n...    31   4.5  

>AE006467-9|AAK61283.1|  473|Homo sapiens similar to portion of
           neuronal pentraxin i precursor NPX1 or NP1 protein.
          Length = 473

 Score = 31.1 bits (67), Expect = 4.5
 Identities = 10/31 (32%), Positives = 18/31 (58%)
 Frame = +2

Query: 656 VGQPVYYIVTLELISPGGWAHLCRRWSMSSG 748
           +G P +  + L+L+  G W H+C  W+ + G
Sbjct: 337 IGDPAFRELPLQLLLDGQWHHICVIWTSTQG 367


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,931,007
Number of Sequences: 237096
Number of extensions: 1901660
Number of successful extensions: 6346
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6318
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6346
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 9127122082
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)