SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30290
         (750 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    24   1.3  
EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.3  
EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.3  
EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.3  
EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.3  
EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.3  
EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.3  
DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholi...    23   2.3  
DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholi...    23   2.3  

>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = -2

Query: 680 VQRPTNTFRMSRRRAVLAVRDANIAPAPVYHVS 582
           V+ P N+ R S   A+ A+   N+   P+Y +S
Sbjct: 177 VEYPQNSKRNSEESAICAMLKENMPEFPLYQLS 209


>EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 6 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = -1

Query: 360 GTPISVGRPA 331
           GTPIS GRPA
Sbjct: 371 GTPISTGRPA 380


>EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 5 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = -1

Query: 360 GTPISVGRPA 331
           GTPIS GRPA
Sbjct: 371 GTPISTGRPA 380


>EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 4 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = -1

Query: 360 GTPISVGRPA 331
           GTPIS GRPA
Sbjct: 371 GTPISTGRPA 380


>EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 3 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = -1

Query: 360 GTPISVGRPA 331
           GTPIS GRPA
Sbjct: 371 GTPISTGRPA 380


>EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 2 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = -1

Query: 360 GTPISVGRPA 331
           GTPIS GRPA
Sbjct: 371 GTPISTGRPA 380


>EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 1 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = -1

Query: 360 GTPISVGRPA 331
           GTPIS GRPA
Sbjct: 371 GTPISTGRPA 380


>DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = -1

Query: 360 GTPISVGRPA 331
           GTPIS GRPA
Sbjct: 439 GTPISTGRPA 448


>DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = -1

Query: 360 GTPISVGRPA 331
           GTPIS GRPA
Sbjct: 439 GTPISTGRPA 448


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 189,731
Number of Sequences: 438
Number of extensions: 4138
Number of successful extensions: 13
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23510295
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -