BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30288 (704 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. 27 0.43 AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. 27 0.43 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 26 1.0 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 1.8 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 1.8 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 3.1 >Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. Length = 115 Score = 27.5 bits (58), Expect = 0.43 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 280 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 384 GG P RYRPG ++ + R + T L+ PF Sbjct: 32 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 66 >AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. Length = 136 Score = 27.5 bits (58), Expect = 0.43 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 280 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 384 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 26.2 bits (55), Expect = 1.0 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +1 Query: 553 LGIKVKIMLPWDQQGKNGPKKATTRPHPGNRAQGRARGPSNPTSEM 690 LG++V L W K KAT H NR GP S + Sbjct: 809 LGVRVHAHLSWVPHVKEITLKATRIVHAVNRLMPNLHGPRTSMSRL 854 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 604 GPKKATTRPHPGNRAQGRARGPSNPTSEMRSPS 702 G + TT HP + A + SNP S PS Sbjct: 504 GSEITTTNTHPKSSASSTSLNHSNPISSSAPPS 536 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 604 GPKKATTRPHPGNRAQGRARGPSNPTSEMRSPS 702 G + TT HP + A + SNP S PS Sbjct: 505 GSEITTTNTHPKSSASSTSLNHSNPISSSAPPS 537 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 428 QIQQLHNHGHQIP**NGEHHSKH 360 Q QQ H H HQ G+HH++H Sbjct: 642 QQQQQHQH-HQAHQHQGQHHAQH 663 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 813,883 Number of Sequences: 2352 Number of extensions: 18207 Number of successful extensions: 36 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -