BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30287 (716 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid t... 36 0.035 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 1.0 At1g19270.1 68414.m02397 ubiquitin interaction motif-containing ... 30 1.8 At5g07790.1 68418.m00892 expressed protein 29 4.1 At5g46740.1 68418.m05758 ubiquitin-specific protease 21 (UBP21) ... 28 5.4 At1g30420.1 68414.m03718 ATP-binding cassette transport protein,... 28 5.4 At5g31873.1 68418.m03777 hypothetical protein 28 7.1 At5g28120.1 68418.m03396 hypothetical protein 28 7.1 At5g28110.1 68418.m03395 hypothetical protein 28 7.1 At3g30816.1 68416.m03949 hypothetical protein 28 7.1 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 27 9.4 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 27 9.4 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 27 9.4 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 27 9.4 At1g30410.1 68414.m03717 ATP-binding cassette transport protein,... 27 9.4 >At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein low similarity to glucoamylase S1/S2 [Precursor] from Saccharomyces cerevisiae [SP|P08640], proteophosphoglycan from Leishmania major [GI:5420387]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 256 Score = 35.5 bits (78), Expect = 0.035 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +1 Query: 127 VRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAA 252 VRH P +H +P +SH++P + ++P + H+ P+V A+ Sbjct: 165 VRHSSPP---VSHSSPPVSHSSPPTSRSSPAVSHSSPVVAAS 203 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +1 Query: 346 QLPSNTPIMSKIMLPRSMSSHIPSRIPTPAI-----TSPNTKPV 462 Q P+ + S++ P S S+ PS+ PTP + +PN+KPV Sbjct: 726 QAPTTSSETSQVPTPSSESNQSPSQAPTPILEPVHAPTPNSKPV 769 >At1g19270.1 68414.m02397 ubiquitin interaction motif-containing protein / LIM domain-containing protein weak similarity to LIM-homeobox protein [Mus musculus] GI:2149584, Hic-5 [Mus musculus] GI:664955; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00412: LIM domain Length = 532 Score = 29.9 bits (64), Expect = 1.8 Identities = 24/88 (27%), Positives = 32/88 (36%), Gaps = 4/88 (4%) Frame = +3 Query: 138 RAFSSSNGTLYPSIESC--CSSTDSRSPFDSTCRSYCSRRPVEHSSYIHASPVVQHFSPV 311 R + N +P C CS S F ST +Y + Y V HF P Sbjct: 183 RFLNCLNSLWHPECFRCYGCSQPISEYEF-STSGNYPFHKACYRERYHPKCDVCSHFIPT 241 Query: 312 QHAPVVHHAAIPIAVEH--SDHVEDHAP 389 HA ++ + A P V+ H D P Sbjct: 242 NHAGLIEYRAHPFWVQKYCPSHEHDATP 269 >At5g07790.1 68418.m00892 expressed protein Length = 616 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 381 HAPAKYEFSYSVEDPH-TGDHKSQHETRDGDVVKGEYSLLQPDGPSARSNTQL 536 H P+ F S DPH +G S+ ++ + KG S L + SA+ T L Sbjct: 337 HCPSNKTFKGSDHDPHSSGQASSESQSNQTSMEKGSSSSLS-EAKSAKKGTSL 388 >At5g46740.1 68418.m05758 ubiquitin-specific protease 21 (UBP21) identical to ubiquitin-specific protease 21 GI:11993482 [Arabidopsis thaliana] Length = 732 Score = 28.3 bits (60), Expect = 5.4 Identities = 25/86 (29%), Positives = 35/86 (40%), Gaps = 3/86 (3%) Frame = +3 Query: 96 PRPCCVFPKHRSP*RAFSSSNGTLYPSIESCCSSTDSRSPFDSTC-RSYCSRRPVEHSSY 272 P CC PK A SS+N I++ S S PF T ++ P E+ +Y Sbjct: 526 PDSCCQEPKEEVFHSAESSNNEDSSAMIDA-LGSPQSEKPFAETSQQTEPESCPTENKAY 584 Query: 273 IHAS--PVVQHFSPVQHAPVVHHAAI 344 I S P + P + P A+I Sbjct: 585 IDKSEKPFAETSQPKEPKPFADRASI 610 >At1g30420.1 68414.m03718 ATP-binding cassette transport protein, putative contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1488 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 137 SWRTMLWEDTAWPWPSSITPPWQIAKIEQTTAILKNMLRCLTE 9 SW T L + + P + WQ+ + +QT ++K RC TE Sbjct: 241 SWMTPLMQ-LGYRKPITERDVWQLDQWDQTETLIKRFQRCWTE 282 >At5g31873.1 68418.m03777 hypothetical protein Length = 271 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 435 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 304 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 196 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 238 >At5g28120.1 68418.m03396 hypothetical protein Length = 506 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 435 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 304 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 394 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 436 >At5g28110.1 68418.m03395 hypothetical protein Length = 493 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 435 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 304 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 394 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 436 >At3g30816.1 68416.m03949 hypothetical protein Length = 342 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 435 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 304 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 231 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 273 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 361 TPIMSKIMLPRSMSSHIPSRIPTPAITSPNTKP 459 +PI S P + S+ S +PA+TSP T P Sbjct: 23 SPISSPTKSPTTPSAPTTSPTKSPAVTSPTTAP 55 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 483 RLSRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRH-DRSVRRQLESQ 337 R SRH H G R G + R R+HD R DR RR S+ Sbjct: 99 RSSRHRDHSRERGERRERGGRDDDDYRRSRDRDHDRRRDDRGGRRSRRSR 148 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 483 RLSRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRH-DRSVRRQLESQ 337 R SRH H G R G + R R+HD R DR RR S+ Sbjct: 99 RSSRHRDHSRERGERRERGGRDDDDYRRSRDRDHDRRRDDRGGRRSRRSR 148 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 483 RLSRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRH-DRSVRRQLESQ 337 R SRH H G R G + R R+HD R DR RR S+ Sbjct: 99 RSSRHRDHSRERGERRERGGRDDDDYRRSRDRDHDRRRDDRGGRRSRRSR 148 >At1g30410.1 68414.m03717 ATP-binding cassette transport protein, putative similar to MgATP-energized glutathione S-conjugate pump [Arabidopsis thaliana] GI:2909781; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1495 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 74 WQIAKIEQTTAILKNMLRCLTE 9 WQ+ K +QT ++K RC TE Sbjct: 261 WQLDKWDQTETLIKRFQRCWTE 282 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,211,553 Number of Sequences: 28952 Number of extensions: 375845 Number of successful extensions: 1436 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1434 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -