BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30286 (715 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces p... 28 1.5 SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual 26 6.1 SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra... 25 8.1 SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccha... 25 8.1 >SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 309 Score = 27.9 bits (59), Expect = 1.5 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 355 DAVSGIGTDEEAIIEILCTLSNYGIRTISAFYEQLYGKSLESD 483 DA++ + +E I E T +Y IRT+S Y+ Y S D Sbjct: 215 DAITSLWDPQELICERSITRMDYPIRTLSFSYDSRYLASGSED 257 >SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1339 Score = 25.8 bits (54), Expect = 6.1 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 444 ILRTTVRQEPGIGLKRRHVG 503 ++ T + +PG LK+RH+G Sbjct: 1171 MMPTNIEHDPGCTLKKRHIG 1190 >SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating transcription Rct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 25.4 bits (53), Expect = 8.1 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +1 Query: 490 GDTSGHSRDCACRCAWPIAMKTRASMKAQLKPMLKH 597 GD G + D RC W + K KA+ P L H Sbjct: 54 GDPLGPTGDGG-RCVWNVLNKGTRFFKAEFNPSLVH 88 >SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccharomyces pombe|chr 3|||Manual Length = 1284 Score = 25.4 bits (53), Expect = 8.1 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +3 Query: 459 VRQEPGIGLKRRHVGTLKRLCVSLCMANRDENQGIDEGSAKADAEALGRRW*RSMGNRRI 638 V +PG +RR + + V+ CM + ID AK E LG R + M + I Sbjct: 449 VPSKPGRRGRRREKNPMGQKIVNACMETMEGYYAIDNLIAK--CEFLGNRISKGMASWGI 506 Query: 639 NLQL 650 L++ Sbjct: 507 KLEM 510 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,636,493 Number of Sequences: 5004 Number of extensions: 49848 Number of successful extensions: 145 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -