BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30285 (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 7.9 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 7.9 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.4 bits (48), Expect = 7.9 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 186 VFKLTATMSSSCYSFNIMLVIRLLVLLFHYFWLQGL 79 VF LT+ + Y F+ L+ +LLV FH+F +G+ Sbjct: 74 VFMLTSPL---LYIFDTKLIKQLLVKDFHHFPNRGV 106 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -1 Query: 499 FQFLGLENLKENFVQEHTV 443 F+F GL++LKE F+Q + + Sbjct: 858 FEFEGLDSLKELFLQYNRI 876 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,066 Number of Sequences: 2352 Number of extensions: 12446 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -