BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30285 (772 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 7.3 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 9.6 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 9.6 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 481 ENLKENFVQEHTVFL 437 +NL NFV + TVFL Sbjct: 322 QNLTVNFVDQSTVFL 336 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 7.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 70 VCNETLKPKIMKQQYQK 120 + TL PK+ ++Q+QK Sbjct: 335 ILKSTLTPKLARKQFQK 351 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 638 KRFYINDIIKISFIF*VPIINYCCMVFYIS 727 K F+I I S + + ++ CC+++ S Sbjct: 54 KHFHIGLAIIYSMLLIMSLVGNCCVIWIFS 83 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 638 KRFYINDIIKISFIF*VPIINYCCMVFYIS 727 K F+I I S + + ++ CC+++ S Sbjct: 54 KHFHIGLAIIYSMLLIMSLVGNCCVIWIFS 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,686 Number of Sequences: 438 Number of extensions: 3949 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -