BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30282 (708 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 5.6 AM269505-4|CAK30051.1| 23|Tribolium castaneum mlpt peptide 4 p... 22 5.6 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 7.4 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 9.8 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.8 bits (44), Expect = 5.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 6/31 (19%) Frame = -3 Query: 649 RNLTPRPSL------MGCVGCIFALLISKAS 575 +NLTP L C+G FALL+SK + Sbjct: 420 KNLTPYTYLPFGEGPRNCIGQRFALLVSKVA 450 >AM269505-4|CAK30051.1| 23|Tribolium castaneum mlpt peptide 4 protein. Length = 23 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 193 GGRDEGSDGNRRR 231 GGR E S G RRR Sbjct: 9 GGRPETSSGRRRR 21 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 288 PTVIMACHFLN 320 P VI+ACH L+ Sbjct: 169 PNVILACHMLS 179 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 9.8 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +1 Query: 346 RKQQMAKEYRVKVEKELREICYDVLGLLDKHLIP 447 R++Q + +V+ E ++ + DV+ ++DK L P Sbjct: 350 RQEQETLKSQVQRESDVVDSLKDVIEIVDKLLNP 383 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,338 Number of Sequences: 336 Number of extensions: 3379 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -