BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30279 (508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.0 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 24 1.0 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 1.4 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 23 2.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.4 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 5.6 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 5.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 5.6 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 5.6 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 21 9.7 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 1.0 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = -2 Query: 330 PWCPDVFARRVLCEGFGFVASLWTFALPNVENLCVFTVWMS 208 P+ D++ + EG F + + F + N + + + T W S Sbjct: 353 PFIKDIYETVIKLEGASFRSKPYRFGIQNGDYVVLETEWSS 393 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 23.8 bits (49), Expect = 1.0 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = -2 Query: 330 PWCPDVFARRVLCEGFGFVASLWTFALPNVENLCVFTVWMS 208 P+ D++ + EG F + + F + N + + + T W S Sbjct: 59 PFIKDIYETVIKLEGASFRSKPYRFGIQNGDYVVLETEWSS 99 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 23.4 bits (48), Expect = 1.4 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 197 VGLASPSLSCSCRFCLRNVMDRFE 126 +G+ + + CSC C+ ++FE Sbjct: 76 LGICAEGMQCSCNKCIGCSAEKFE 99 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 200 PVGLASPSLSCSCRFCLRNVMDRFESNVELI 108 P LAS + CLR+ + + ESN+++I Sbjct: 159 PAYLASKCALTTLTDCLRSELAQCESNIKVI 189 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 79 ARVNVARVWINVTIFCFNSTSYW 11 AR+ VA VWI + CF W Sbjct: 182 ARLLVATVWILSFVICFPPLVGW 204 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 5.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 228 VFTVWMSMFAGRSCVSFSIV 169 +FT+W S+FA + V IV Sbjct: 311 LFTIWGSLFAKANAVYNPIV 330 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 91 GPCNWTINSTLLSNRSITFRRQKRQL 168 G C + I+ + ++N + FRR R++ Sbjct: 187 GSCAFGIDMSSMTNENSEFRRMGREV 212 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 5.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 306 ERTHQGTRATCLPTLLYPLRSP 371 ERTH+ T A TL +RSP Sbjct: 878 ERTHRPTFANLTQTLDKLIRSP 899 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/26 (26%), Positives = 16/26 (61%) Frame = -3 Query: 326 GALMCSLVVYSVKVLGSSPLCGLSLY 249 G L+C LV +++ + + +CG+ + Sbjct: 701 GILLCYLVTFALVLRPTDIVCGIQRF 726 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +2 Query: 113 ILHYSQIDPSHFE 151 I+H+ QI+P +E Sbjct: 542 IIHFKQIEPGKYE 554 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 228 VFTVWMSMFAGRSCV 184 +FT+W S+FA + V Sbjct: 61 LFTIWGSLFAKANAV 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,049 Number of Sequences: 438 Number of extensions: 2736 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -