BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30274 (723 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC001460-1|AAH01460.2| 1019|Homo sapiens La ribonucleoprotein do... 32 1.8 AK091465-1|BAC03668.1| 816|Homo sapiens protein ( Homo sapiens ... 32 1.8 AB018274-1|BAA34451.1| 1096|Homo sapiens KIAA0731 protein protein. 32 1.8 BC133012-1|AAI33013.1| 135|Homo sapiens FLJ40142 protein protein. 32 2.4 BC133010-1|AAI33011.1| 135|Homo sapiens FLJ40142 protein protein. 32 2.4 AK097461-1|BAC05063.1| 135|Homo sapiens protein ( Homo sapiens ... 32 2.4 >BC001460-1|AAH01460.2| 1019|Homo sapiens La ribonucleoprotein domain family, member 1 protein. Length = 1019 Score = 32.3 bits (70), Expect = 1.8 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +3 Query: 129 ITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQI--AKIAALTVVAPPS-SWEP 275 I MKPE P ++ S PP RH + +I ++ A VAPP+ +W+P Sbjct: 180 IDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQP 231 >AK091465-1|BAC03668.1| 816|Homo sapiens protein ( Homo sapiens cDNA FLJ34146 fis, clone FCBBF3011889, weakly similar to Drosophila melanogaster La related protein (larp) mRNA. ). Length = 816 Score = 32.3 bits (70), Expect = 1.8 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +3 Query: 129 ITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQI--AKIAALTVVAPPS-SWEP 275 I MKPE P ++ S PP RH + +I ++ A VAPP+ +W+P Sbjct: 257 IDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQP 308 >AB018274-1|BAA34451.1| 1096|Homo sapiens KIAA0731 protein protein. Length = 1096 Score = 32.3 bits (70), Expect = 1.8 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +3 Query: 129 ITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQI--AKIAALTVVAPPS-SWEP 275 I MKPE P ++ S PP RH + +I ++ A VAPP+ +W+P Sbjct: 257 IDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQP 308 >BC133012-1|AAI33013.1| 135|Homo sapiens FLJ40142 protein protein. Length = 135 Score = 31.9 bits (69), Expect = 2.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 427 PTLCMEYRPCCLQCYLRRASRHLHDPVFQRRRTQPCR 537 P C++ CCL C L +ASR +H V R + C+ Sbjct: 31 PDGCVQSWRCCLPCDLGQASRFIHTTVCSAIRWRSCK 67 >BC133010-1|AAI33011.1| 135|Homo sapiens FLJ40142 protein protein. Length = 135 Score = 31.9 bits (69), Expect = 2.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 427 PTLCMEYRPCCLQCYLRRASRHLHDPVFQRRRTQPCR 537 P C++ CCL C L +ASR +H V R + C+ Sbjct: 31 PDGCVQSWRCCLPCDLGQASRFIHTTVCSAIRWRSCK 67 >AK097461-1|BAC05063.1| 135|Homo sapiens protein ( Homo sapiens cDNA FLJ40142 fis, clone TESTI2012922. ). Length = 135 Score = 31.9 bits (69), Expect = 2.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 427 PTLCMEYRPCCLQCYLRRASRHLHDPVFQRRRTQPCR 537 P C++ CCL C L +ASR +H V R + C+ Sbjct: 31 PDGCVQSWRCCLPCDLGQASRFIHTTVCSAIRWRSCK 67 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,591,989 Number of Sequences: 237096 Number of extensions: 2175828 Number of successful extensions: 5499 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5497 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -