BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30272 (573 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 3.8 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 3.8 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 6.6 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 6.6 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 6.6 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 6.6 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 8.7 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 8.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 8.7 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 456 STSRSRNGASSTLSPFGCKHRAEGRCHGRPS 364 S S+S+ + S++S + + G C RPS Sbjct: 22 SNSQSQRSSGSSISRNSNRSESSGYCGRRPS 52 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 456 STSRSRNGASSTLSPFGCKHRAEGRCHGRPS 364 S S+S+ + S++S + + G C RPS Sbjct: 22 SNSQSQRSSGSSISRNSNRSESSGYCGRRPS 52 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 408 GCKHRAEGRC 379 GC R EGRC Sbjct: 132 GCGERTEGRC 141 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 408 GCKHRAEGRC 379 GC R EGRC Sbjct: 137 GCGERTEGRC 146 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 408 GCKHRAEGRC 379 GC R EGRC Sbjct: 137 GCGERTEGRC 146 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 6.6 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 370 AFSMSLAMES-GINLFTTSLSSELVTSRVM 284 A S+S E G +L T+LSS LV SRV+ Sbjct: 599 ASSVSAGEEGLGNSLAITALSSILVLSRVI 628 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 551 KHSLEREARSPPAVRLVSGFPLASTAFAVKFHQ 453 +HS + SP A S +P S A A HQ Sbjct: 70 QHSGSSASTSPAARTTSSMYPYVSAAAAHHHHQ 102 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/38 (21%), Positives = 22/38 (57%) Frame = +1 Query: 37 EYVQGRNVLCNFHGMDLTTDKLRWMVKKWQTLIEANID 150 +Y++ N+ +GM + DK+ + +W+ + +N++ Sbjct: 45 DYIEENNMP---NGMQIWNDKVFITIPRWKNGVPSNLN 79 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 166 HRLSSHQCWLR*ES 125 H LS H+C++R E+ Sbjct: 554 HNLSLHKCFMRVEN 567 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,351 Number of Sequences: 438 Number of extensions: 3287 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -