BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30271 (765 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 2.6 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 2.6 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 3.4 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 7.8 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 349 NRQQNCVDFVRRGLPMNTPLKRTVPSPSSIFVLEPIFSPF 230 +R + V V+R + + PL++T P P+S P+ +PF Sbjct: 498 HRDPDVVQSVQRPVYVALPLEQTTPVPTST-TSRPLRTPF 536 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 349 NRQQNCVDFVRRGLPMNTPLKRTVPSPSSIFVLEPIFSPF 230 +R + V V+R + + PL++T P P+S P+ +PF Sbjct: 497 HRDPDVVQSVQRPVYVALPLEQTTPVPTST-TSRPLRTPF 535 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.6 bits (51), Expect = 3.4 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +3 Query: 165 KHLERVTMKLTLITKVWT--LP*LKGEKIGSSTN-IEDGLGTVRFNGVFIGRPLRTKST 332 +HLERV K + IT T +P +G K S I G +R+ GR + K T Sbjct: 741 RHLERVANKASRITNALTCLMPNKRGPKSRSRRQLINVGNSIIRYGVATWGRWVLDKET 799 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 7.8 Identities = 9/36 (25%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +2 Query: 383 LPRTTRCLY-MSDLLVANRAEGSIDKIQDTVLIHLI 487 L + C+ + D+ V +GS+D+ + + +HL+ Sbjct: 1642 LSNVSGCIVNIDDIRVHENPDGSVDRTKSDMFMHLV 1677 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 819,407 Number of Sequences: 2352 Number of extensions: 17394 Number of successful extensions: 97 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -