BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30270 (725 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q38EZ9 Cluster: Putative uncharacterized protein; n=1; ... 33 7.2 UniRef50_A0BHI3 Cluster: Chromosome undetermined scaffold_108, w... 33 7.2 >UniRef50_Q38EZ9 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 151 Score = 33.1 bits (72), Expect = 7.2 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 1/82 (1%) Frame = -2 Query: 658 ILPPDKFDNKQIVCMCVCQ-IHGSVCDVFLSIIKKNLIILHSCIFSASVGNSYSSVRVIF 482 +L P F + +CMC+C +H VC VF + L++L +F S GNS S++ F Sbjct: 39 VLTPVSF--RVCMCMCMCMCVH--VCCVFFLLFLLILLLL-LFLFFVSAGNSKSNIPATF 93 Query: 481 K*KGLQSFCFTY*YIDVLYYNV 416 +C+ + Y L +++ Sbjct: 94 --HHYYYYCYLFIYSFYLLFSI 113 >UniRef50_A0BHI3 Cluster: Chromosome undetermined scaffold_108, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_108, whole genome shotgun sequence - Paramecium tetraurelia Length = 318 Score = 33.1 bits (72), Expect = 7.2 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = -2 Query: 706 LLYFYIKDKQYLNLF*ILPPDKFDNKQIVCMCVCQIHGSVCDVFLSIIKKNLIILHSCIF 527 L+Y ++KD Y F L ++ + + ++H + VFL I NL+ + I Sbjct: 184 LIYIFLKDYDYEKDFTELDVSQWASLVFSSLLASRLHNEL-QVFLMIFASNLLFIFVPIL 242 Query: 526 SASVGNSYSSV-RVI 485 S+ Y+SV RVI Sbjct: 243 QRSIKQKYNSVFRVI 257 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,892,307 Number of Sequences: 1657284 Number of extensions: 11434845 Number of successful extensions: 20954 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20928 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 59090914597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -