BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30269 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 128 6e-30 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 1e-26 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 112 3e-25 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 98 7e-21 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 4e-17 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 33 0.23 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 33 0.23 SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 32 0.40 SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 31 0.71 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 0.94 SB_42043| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) 30 2.2 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 30 2.2 SB_28335| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_7408| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) 29 2.8 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 2.8 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_15899| Best HMM Match : PAN (HMM E-Value=0.00033) 29 3.8 SB_1024| Best HMM Match : Ank (HMM E-Value=0) 29 3.8 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 29 3.8 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) 29 3.8 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 29 5.0 SB_34814| Best HMM Match : DUF1685 (HMM E-Value=4.3) 29 5.0 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_31531| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_42550| Best HMM Match : RhoGAP (HMM E-Value=0) 29 5.0 SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) 29 5.0 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_39065| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_33413| Best HMM Match : DUF81 (HMM E-Value=0.31) 28 6.6 SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 28 6.6 SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) 28 6.6 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 28 8.7 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_49873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_48166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 28 8.7 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 28 8.7 SB_12881| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 28 8.7 SB_10182| Best HMM Match : Transformer (HMM E-Value=9.9) 28 8.7 SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) 28 8.7 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 28 8.7 SB_2761| Best HMM Match : zf-TRAF (HMM E-Value=0.26) 28 8.7 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 128 bits (308), Expect = 6e-30 Identities = 52/86 (60%), Positives = 73/86 (84%) Frame = -2 Query: 506 KYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDS 327 KY+ ED+KQ++ IQ KN+LESY +SMKST+ED+K+K+KIS+ DK+ ILD C + +KWLD+ Sbjct: 526 KYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKISEEDKKAILDKCTEVLKWLDT 585 Query: 326 NQLADKEEYEHKQKELEGICNPIIRR 249 NQ A+K+E+E+ QKELE +CNPII + Sbjct: 586 NQTAEKDEFEYHQKELEKVCNPIITK 611 Score = 123 bits (297), Expect = 1e-28 Identities = 58/62 (93%), Positives = 61/62 (98%) Frame = -3 Query: 694 LTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVN 515 LTGIPPAPRGVPQIEVTFDIDANGILNVSA++KST KENKITITNDKGRLSKE+IERMVN Sbjct: 463 LTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVN 522 Query: 514 EA 509 EA Sbjct: 523 EA 524 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 116 bits (280), Expect = 1e-26 Identities = 53/62 (85%), Positives = 60/62 (96%) Frame = -3 Query: 694 LTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVN 515 L+GIPPAPRGVPQI+VTFD+D+NGILNVSA++KST KENKITITNDKGRLSKE+IERMV Sbjct: 555 LSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVK 614 Query: 514 EA 509 EA Sbjct: 615 EA 616 Score = 111 bits (268), Expect = 4e-25 Identities = 46/87 (52%), Positives = 68/87 (78%) Frame = -2 Query: 509 KKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLD 330 +K++ D+ +E IQ+KN+LESY FSMKSTMEDEK+K+K+S+ +++ ++ C T+ WL+ Sbjct: 617 EKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDEREKVISRCKATLDWLE 676 Query: 329 SNQLADKEEYEHKQKELEGICNPIIRR 249 NQ A+KEE + QKELEG+CNPII + Sbjct: 677 HNQSAEKEEIDAHQKELEGVCNPIITK 703 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 112 bits (269), Expect = 3e-25 Identities = 53/73 (72%), Positives = 62/73 (84%) Frame = -3 Query: 694 LTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVN 515 L+GIPPAPRGVPQIEVTFDIDANGILNVSA +KST K ITITNDKGRLSKEEI+RM+N Sbjct: 462 LSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMIN 521 Query: 514 EARSTETRMTSKR 476 +A ++ ++R Sbjct: 522 DAEKYKSEDEAQR 534 Score = 96.3 bits (229), Expect = 2e-20 Identities = 38/87 (43%), Positives = 63/87 (72%) Frame = -2 Query: 509 KKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLD 330 +KY++ED+ Q+E I A+N LESY F +KS + + L+ K+S SDK T+ + + + WL+ Sbjct: 524 EKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKLSQSDKDTVKNKVEEVLNWLE 583 Query: 329 SNQLADKEEYEHKQKELEGICNPIIRR 249 N LA+KEE+E ++KEL+ +C+PI+ + Sbjct: 584 KNSLAEKEEFEEQEKELQRVCSPIMAK 610 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 97.9 bits (233), Expect = 7e-21 Identities = 48/79 (60%), Positives = 60/79 (75%), Gaps = 2/79 (2%) Frame = -3 Query: 694 LTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVN 515 L GIPPAPRGVPQIEVTF+ID NGIL VSA +K T + KITITND+ RL+ E+IERMVN Sbjct: 1156 LNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVN 1215 Query: 514 EAR--STETRMTSKRRPSR 464 +A + E + T ++ +R Sbjct: 1216 DAEKFADEDKKTKEKVEAR 1234 Score = 71.7 bits (168), Expect = 5e-13 Identities = 32/84 (38%), Positives = 57/84 (67%), Gaps = 1/84 (1%) Frame = -2 Query: 509 KKYRNEDDKQKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDNCNDTIKWL 333 +K+ +ED K KE ++A+N LESY +S+K+ + D EKL K+S+ DK+TI + I W+ Sbjct: 1218 EKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTITEAVEKAISWM 1277 Query: 332 DSNQLADKEEYEHKQKELEGICNP 261 D NQ A E+++ ++++ + + +P Sbjct: 1278 DKNQDASVEDFKKEKRKWKMLYSP 1301 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 85.4 bits (202), Expect = 4e-17 Identities = 41/62 (66%), Positives = 48/62 (77%) Frame = -3 Query: 694 LTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVN 515 L GIPPAPRGVPQ+EVTFDIDANGI+NVSA +K T +E +I I G LSK+ IE M+ Sbjct: 267 LVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVI-QSSGGLSKDAIENMIK 325 Query: 514 EA 509 EA Sbjct: 326 EA 327 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -2 Query: 491 DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS-DSDKQTILDNCNDTIKWLDSN 324 DD + +AKNALES+ F ++ M E L EK+S +++++TI + WLD + Sbjct: 710 DDAKAANERAKNALESHIFGVRDEMNSE-LGEKLSTEAERETISEALTAASDWLDED 765 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 35.1 bits (77), Expect = 0.057 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 10/87 (11%) Frame = -2 Query: 398 EKISDSDKQTILDNCNDTIKWL--------DSNQLADKEEYEHKQKELEGICNPIIRR-C 246 E I S+ +L+ C D + W+ DS+ ++KEE E +++EL P R Sbjct: 705 EGIDVSELLEVLEPCGDAVLWIRIQSMDAEDSSSDSEKEEEEEEEEELSDDDRPEAERGA 764 Query: 245 TRVPEESPEVCRASRAEHPEPE-VPPP 168 ++ E C++ +P+ VPPP Sbjct: 765 EESSKQLKEACKSRPPRPAQPKRVPPP 791 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 33.1 bits (72), Expect = 0.23 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 2/88 (2%) Frame = -2 Query: 380 DKQTILDNCNDTIKWLDSNQLADKEEYEHKQKELEGI--CNPIIRRCTRVPEESPEVCRA 207 +KQT D +D +W+ N + D EY + K+ + C C ++P SP Sbjct: 95 EKQTCRDERSDC-EWI-LNNVDDIGEYCERWKDDPAVRKCRKTCGLCNKIP--SPP---- 146 Query: 206 SRAEHPEPEVPPPGLEALAPPSRRSIKP 123 + E PEPE PP E + PP ++ P Sbjct: 147 NPTEAPEPETVPPQPETV-PPQPETVPP 173 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 33.1 bits (72), Expect = 0.23 Identities = 19/75 (25%), Positives = 41/75 (54%), Gaps = 2/75 (2%) Frame = -2 Query: 467 QAKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDNCNDTIKWLDSN-QLADKEEYEH 294 +A+ L++ S K T+ D +K + + D+ + C++ +WL++N A EE Sbjct: 734 EAQFELKALITSTKETIADPDKHMGRFTKDDRVSGNRYCDEKSEWLENNADTASLEEIVK 793 Query: 293 KQKELEGICNPIIRR 249 ++++L G+ PI+ + Sbjct: 794 QKEDLAGVLQPILSK 808 >SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 32.7 bits (71), Expect = 0.31 Identities = 28/126 (22%), Positives = 62/126 (49%), Gaps = 2/126 (1%) Frame = -2 Query: 647 HLRHRCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETI 468 +++H + +R+ RE ++GE+D +R+R + RDR G++ R E D++++ Sbjct: 110 NVKHSGRVDSERYEDREDRERGERDRDRRRERDRGE-RDRGERDRGERDRGERDRRRDRD 168 Query: 467 QAKNALESYCFSMKS-TMEDEKLKEKISDSDK-QTILDNCNDTIKWLDSNQLADKEEYEH 294 + ++ +S + E ++ EK D D+ + D D + D + D ++ Sbjct: 169 RDRDRDRDRERRRRSRSREKDREGEKPRDRDRDRRHRDRDRDKERDKDRDYHRDNDKVRQ 228 Query: 293 KQKELE 276 + +E+E Sbjct: 229 EDEEME 234 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 32.3 bits (70), Expect = 0.40 Identities = 34/137 (24%), Positives = 60/137 (43%), Gaps = 9/137 (6%) Frame = -2 Query: 485 KQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKE 306 K+KE + ++ L + E K++++ + DKQ + D++K + + +DKE Sbjct: 975 KEKERLLQEDKLHEKEEKDRKDKEKRKVEKEKREKDKQVEKEK-KDSLKRVKKRKDSDKE 1033 Query: 305 ----EYEHKQK-ELEGICNPIIRRCTRVPE----ESPEVCRASRAEHPEPEVPPPGLEAL 153 E E +QK ++E N + V E ESP R + +E P+ L Sbjct: 1034 RKVKEKEEEQKVKIEKEPNKVTEVQLMVEETNKEESPSTDRDAESELPKAGSVSALLSVF 1093 Query: 152 APPSRRSIKPTFHTTRK 102 A + +KP +RK Sbjct: 1094 ATEPSKPLKPAIRYSRK 1110 >SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 31.9 bits (69), Expect = 0.53 Identities = 13/69 (18%), Positives = 36/69 (52%) Frame = -2 Query: 647 HLRHRCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETI 468 H +H+ ++ Q+ +Y++ HQ Q H Q+Q+ Q + + ++ + + +Q++ + Sbjct: 291 HQQHQLHQHQQQHQYQQQHQHQHQHQHQQQQQQQQQQQQQQQ---QQQQQQQQQQQQQQL 347 Query: 467 QAKNALESY 441 Q + + + Sbjct: 348 QQQQQQQQH 356 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 31.5 bits (68), Expect = 0.71 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = -2 Query: 488 DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIK 339 D QKE QA +E Y S++ E KE + S+K+ + + C + IK Sbjct: 20 DLQKEVTQASENIEKYSQSIRDLGE----KENVLTSEKKQLEEECQENIK 65 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 31.1 bits (67), Expect = 0.93 Identities = 32/145 (22%), Positives = 67/145 (46%), Gaps = 1/145 (0%) Frame = -2 Query: 629 QRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNED-DKQKETIQAKNA 453 +R ++ R R ++ ++D + R + RDR + R++D DK+++ + + Sbjct: 331 ERKDKKDRDRGRNKDRDRDKERDKDRDRDKERDREKD----RERDKDRDKERDRDKDRER 386 Query: 452 LESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKEEYEHKQKELEG 273 + + +K +++ D DK+ D D K D ++ D++ + K+K + Sbjct: 387 EKDRDKERDRDKDRDKERDRDKDRDKERDRDRDRDRDKERDKDRHRDRDRRDRKEKTRD- 445 Query: 272 ICNPIIRRCTRVPEESPEVCRASRA 198 R +R P ESP+ R+SR+ Sbjct: 446 -------RTSRSPSESPK--RSSRS 461 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 25.8 bits (54), Expect(2) = 0.94 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = -2 Query: 308 EEYEHKQKELEG--ICNPIIRRCTRVPEESPEVCRASRAEHPEPEVPPPGLEALAPPS 141 EE Q ++G I N + RR R PE+ EV S + P L+ L PPS Sbjct: 6 EESMELQNSVQGEKIRNIMSRR--RFPEDDLEVSSVSASASSSTSRPTNALQPLKPPS 61 Score = 23.8 bits (49), Expect(2) = 0.94 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 155 LAPPSRRSIKPTFHTTRKPTCNNH 84 L PPSR+S P HT P+C ++ Sbjct: 80 LTPPSRQSNNPRPHT--PPSCQSN 101 >SB_42043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = -2 Query: 635 RCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKY---RNEDDK 483 R QRY + + RE HQ+G HH R S + RD GK+Y R++ DK Sbjct: 134 RDQRY-RDYEDRERHQRGRDRHHRDRDDSGCRFRDNE----GKRYSDLRHDGDK 182 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 7/62 (11%) Frame = -2 Query: 434 SMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSN------QLADK-EEYEHKQKELE 276 S K ++ +K ++ D +K+ ++ C TIK LDSN Q+AD+ EE + ++ELE Sbjct: 174 SNKLVVDLQKTRKAQDDCEKE--VNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELE 231 Query: 275 GI 270 + Sbjct: 232 SV 233 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 1.6 Identities = 23/115 (20%), Positives = 53/115 (46%) Frame = -2 Query: 620 PQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETIQAKNALESY 441 P R YRE ++ ++ ++++ + + + KK + +K K+ + K E Sbjct: 8 PMRREYREEKKRKKKKQKKKKKKKKKKKKKK-----NKKNKKNKNKNKKKKKMKKKKEEE 62 Query: 440 CFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKEEYEHKQKELE 276 + T+E E +EKI +++K+ + + + + ++EE E ++E E Sbjct: 63 AEVGEKTLEAENEEEKIEETEKEKDEEEKIEEEEKEGGEEENEEEEEEETEEEEE 117 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 29.9 bits (64), Expect = 2.2 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 1/92 (1%) Frame = -2 Query: 500 RNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQ 321 +N E + + + SY K + EK KEK + +K+ ILD K++ N Sbjct: 1081 KNSQTPLLEILSPRKDIGSYKSCPKLRKKREKEKEKDKEKEKEVILD-FEALDKFIGRNP 1139 Query: 320 LADKEEY-EHKQKELEGICNPIIRRCTRVPEE 228 + E+ E + ELE I + R EE Sbjct: 1140 MTQIAEFREAEAAELEAIRKLRVMHADRQNEE 1171 >SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) Length = 82 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -2 Query: 428 KSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKEEYEHKQKEL 279 K T ED++ ++K ++SD Q + N T K +L + +E K+ EL Sbjct: 33 KVTQEDQEPEKKSNESDPQKDQETDNKTSKKESQEELREADETPKKKDEL 82 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 29.9 bits (64), Expect = 2.2 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = -2 Query: 236 PEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHT-----TRKPTC 93 P + P R SR E P PE PP L+ LA P+ + +P+ T R PTC Sbjct: 19 PAKKPPPRRRSR-ETP-PETPPVQLKHLAGPAEKPHRPSRETPPVQPRRNPTC 69 >SB_28335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1051 Score = 29.9 bits (64), Expect = 2.2 Identities = 21/91 (23%), Positives = 43/91 (47%) Frame = -2 Query: 638 HRCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETIQAK 459 +R + PQ F R QQ +Q + RQ + ++ R+R +K + + ++ +++ +K Sbjct: 33 NRSAQSPQHFNSRSNQQQQQQGNSIFRQATPIRQREREI----EKEKQQAPERLQSLHSK 88 Query: 458 NALESYCFSMKSTMEDEKLKEKISDSDKQTI 366 E+ T + ++KEK +K I Sbjct: 89 LHQEAEKIRKWKTSTELEIKEKFPQFNKNGI 119 >SB_7408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 2.2 Identities = 20/94 (21%), Positives = 41/94 (43%) Frame = -2 Query: 629 QRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETIQAKNAL 450 QR QR R R+ H+Q ++ QRQR + R R ++ R +++ Q + Sbjct: 36 QRQRQRQRQRQRHRQRQRQRQRQRQRQRQRQRQRQ----RQRQRQRQRQRQRQRQRQRLR 91 Query: 449 ESYCFSMKSTMEDEKLKEKISDSDKQTILDNCND 348 + + ++ + +D+D + D+ +D Sbjct: 92 QRQRLRQRQRQRQQQRNDNDNDNDNRNDNDHDHD 125 >SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) Length = 782 Score = 29.5 bits (63), Expect = 2.8 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 8/77 (10%) Frame = -2 Query: 479 KETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDS--------N 324 KE +Q + L ++ + K +E EK+ IS +D + +L+ D K + + Sbjct: 299 KERLQIERKLANFTKTSKKEVESEKV---ISRTDGKKVLELEKDISKKKNEIRRLRTELS 355 Query: 323 QLADKEEYEHKQKELEG 273 QL + +++H +KELEG Sbjct: 356 QLQENSKHKHFEKELEG 372 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 191 PEPEVPPPGLEALAPPSRRSIKP-TFHTTRKPTCNNHLVTSP 69 P+P+ PPPG PPS + P T +P VT P Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQP 69 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -3 Query: 604 IEKSTNKENKITITNDKGRLSKEEIERMVNEARSTETRMTSKRR 473 +++ KE + +K R KEE ER+ + R E R+ KR+ Sbjct: 203 MDELRKKEERRRKREEKRRKKKEEQERLEQQRRQREQRIAEKRK 246 >SB_15899| Best HMM Match : PAN (HMM E-Value=0.00033) Length = 234 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = +2 Query: 242 WYIFVLSDCKCLPILSA-CAHTPPCRPVGWNPAT*WCRCN----CRGWSACQSQRSF 397 + I+ S K + + + C + P CR + ++PAT C N G SA + Q S+ Sbjct: 168 YVIYTASAVKSMHVCAQYCEYLPRCRSINYSPATMVCEMNNVTSSMGTSAAREQFSY 224 >SB_1024| Best HMM Match : Ank (HMM E-Value=0) Length = 891 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -2 Query: 236 PEESP--EVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPT 120 PE+ P EV A R E P+ E PP +PP ++ KPT Sbjct: 771 PEQPPIGEVESAVRREQPKSEKTPPSTTP-SPPPKQPSKPT 810 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 3/81 (3%) Frame = -2 Query: 599 EVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYR---NEDDKQKETIQAKNALESYCFSM 429 EV Q + ++Q + +Q R+ Y KK + + K++E Q + E ++ Sbjct: 154 EVAAQQQIKELEKKQAAKIQHREALYAEMRKKEEERMSRERKERERRQQEFIKEQKDVAV 213 Query: 428 KSTMEDEKLKEKISDSDKQTI 366 + + E LKE + + +K+TI Sbjct: 214 QQKAQQESLKETLQEQEKETI 234 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/74 (27%), Positives = 35/74 (47%) Frame = -2 Query: 509 KKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLD 330 K+ E K K + + A E S++ ++ E+ EK ++T D N TI +L+ Sbjct: 1662 KEQNIESIKDKLWAEFEEAKED---SVREALDSER--EKWRKEYEKTTQDEINKTISYLE 1716 Query: 329 SNQLADKEEYEHKQ 288 EE++HK+ Sbjct: 1717 DQYTRGLEEFKHKE 1730 >SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1432 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 553 GRLSKEEIERMVNEARSTETRMTSKRRPSRPR 458 GR KEE E + TE + T KR+ RPR Sbjct: 681 GRKKKEESEYDDEDGSDTENKETGKRKRGRPR 712 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 553 GRLSKEEIERMVNEARSTETRMTSKRRPSRPR 458 GR KEE E + TE + T KR+ RPR Sbjct: 786 GRKKKEESEYDDEDGSDTENKETGKRKRGRPR 817 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 28.7 bits (61), Expect = 5.0 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -3 Query: 601 EKSTNKENKITITNDKGRLSKEEIERMV----NEARSTETRMTSKR 476 +K+ + NKI + N+ + SKE++ER V N R T++ M R Sbjct: 1031 DKTRRQLNKILVENENLKGSKEDLERRVVVAENRLRDTDSEMKGWR 1076 >SB_34814| Best HMM Match : DUF1685 (HMM E-Value=4.3) Length = 330 Score = 28.7 bits (61), Expect = 5.0 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = -2 Query: 434 SMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKEEYEHKQK 285 S K TME E K ++K L N T WL + DK++ E K Sbjct: 65 SSKGTMESEPAV-KAKGANKHLTLQNARATENWLRVKNVLDKQKKEISSK 113 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.7 bits (61), Expect = 5.0 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -2 Query: 215 CRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTRKPT 96 C A A+ P+ +VPPP APP + P TT PT Sbjct: 92 CNAKPAQ-PDTDVPPPPATTSAPPPPTTTAPP-ATTSPPT 129 >SB_31531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 28.7 bits (61), Expect = 5.0 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 6/83 (7%) Frame = -2 Query: 407 KLKEKISDSDKQTILDNCNDTIKW------LDSNQLADKEEYEHKQKELEGICNPIIRRC 246 +L E +S D + I+D + +++ L S L ++E + +ELE + I + Sbjct: 190 QLHEMMSIEDVERIMDETKEAVEYQKEIDDLLSGSLTSEDE-DAVLQELEALTESISEKF 248 Query: 245 TRVPEESPEVCRASRAEHPEPEV 177 VP+E PE+ A EP V Sbjct: 249 PDVPKEEPEI-SLPEAPSTEPGV 270 >SB_42550| Best HMM Match : RhoGAP (HMM E-Value=0) Length = 790 Score = 28.7 bits (61), Expect = 5.0 Identities = 23/107 (21%), Positives = 43/107 (40%), Gaps = 4/107 (3%) Frame = -2 Query: 638 HRCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETIQAK 459 +RC + ++ E + E+D R LQ ++R + ++ N + + T + Sbjct: 58 NRCSKMNLHIKHSEGYDSDEEDLITLSSRWKLQNKNRKWARRKRRSSNMSNSETSTNSSS 117 Query: 458 NALESYCF----SMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLD 330 N + S KS + D + + Q + DN DT+ LD Sbjct: 118 NNNSNRSILNSGSSKSVISDRGINSTVRQLSLQAV-DNGPDTLSPLD 163 >SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) Length = 758 Score = 28.7 bits (61), Expect = 5.0 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 7/110 (6%) Frame = -2 Query: 494 EDDKQKETIQAKNALESYCFSMKSTM---EDEKLKEKISDSDKQTILDNCNDTIKWLDSN 324 E+ + + + AK E F ++ M EDE K + K D ++ I+ L+ Sbjct: 376 ENFRLQNELDAKRNYEEEYFELRQRMQEAEDEMASMKHEYATKTGESDFLSERIELLEKE 435 Query: 323 QLADKEEYEHKQKELEGICNPIIRRCTRVPEES----PEVCRASRAEHPE 186 L + EYE + +EL+ + + C + E+ EV + S PE Sbjct: 436 ILDMRVEYEGQIRELQNENLDLRKECLELDNENKILEDEVKQLSEGSTPE 485 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/67 (26%), Positives = 36/67 (53%) Frame = -2 Query: 476 ETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKEEYE 297 E + L+ + M + E E +KE + +++++ C +T K LD+++ D+E+ E Sbjct: 1059 EAVDEAKTLKESLYRMVN--EHETMKESLLNANREIGRLKCENTAKNLDADRKEDQED-E 1115 Query: 296 HKQKELE 276 Q+E E Sbjct: 1116 EVQREGE 1122 Score = 28.7 bits (61), Expect = 5.0 Identities = 24/98 (24%), Positives = 45/98 (45%) Frame = -2 Query: 599 EVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETIQAKNALESYCFSMKST 420 E+ + Q ++ + S ++GR +A K +E K +ET++ K LE M+ Sbjct: 2675 ELQRLTNQIEDFKTKLSEVEGRVKAANSEKKTIEDEVKKLRETVEDKEELEEILGEMRD- 2733 Query: 419 MEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKE 306 + ++L + I + + D+ D + L N DKE Sbjct: 2734 -KRKRLHDDIEKALNER--DDFEDELLELKKNVKLDKE 2768 >SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -2 Query: 416 EDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKEEYEHKQKE 282 EDE+ E SD D +T + +++ +D ++ D+EE HK +E Sbjct: 118 EDEEKTESESDDDDKTEKYSDDESDVSMDGDESDDEEEGPHKPEE 162 >SB_39065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 28.3 bits (60), Expect = 6.6 Identities = 17/109 (15%), Positives = 53/109 (48%) Frame = -2 Query: 602 REVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETIQAKNALESYCFSMKS 423 ++ HQ+ EQ+ Q+Q+ Q +++ ++ E ++++E Q + + + Sbjct: 14 QQQHQEQEQEQQQQQQQQEEQEQEQEQ---EQEQEQEQEQEQEQEQEQEQEQEQEQEQEQ 70 Query: 422 TMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKEEYEHKQKELE 276 E E+ +E+ + +++ + + + + Q ++E+ + +++E E Sbjct: 71 EQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQE 119 >SB_33413| Best HMM Match : DUF81 (HMM E-Value=0.31) Length = 455 Score = 28.3 bits (60), Expect = 6.6 Identities = 8/22 (36%), Positives = 17/22 (77%) Frame = -2 Query: 413 DEKLKEKISDSDKQTILDNCND 348 D +++ ++ D D+QT+ D+C+D Sbjct: 378 DVEVRRRVQDIDRQTVTDDCDD 399 >SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/37 (29%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 356 CNDTIKWLDSN-QLADKEEYEHKQKELEGICNPIIRR 249 C++ +WL++N A EE ++++L G+ PI+ + Sbjct: 7 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSK 43 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 28.3 bits (60), Expect = 6.6 Identities = 23/111 (20%), Positives = 54/111 (48%), Gaps = 2/111 (1%) Frame = -2 Query: 602 REVHQQGEQDHHYQRQRSSLQGR--DRAYG**GKKYRNEDDKQKETIQAKNALESYCFSM 429 R+VH++ Q + Y+++ L+ + D A K + D+ Q + + + Y + Sbjct: 903 RKVHEK--QQNSYEKRNEGLEKKLMDEANERTKIKAKYNDEIQTLIEEQRELVRKYESQI 960 Query: 428 KSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQLADKEEYEHKQKELE 276 K+ +ED K + +D + + + +K L + L ++E+E + ++L+ Sbjct: 961 KTVVEDSKTRILKLINDHENVETDYKKQLKALKNEILRVEDEHEVEIRQLK 1011 >SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) Length = 1152 Score = 28.3 bits (60), Expect = 6.6 Identities = 19/77 (24%), Positives = 36/77 (46%) Frame = -2 Query: 608 RYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETIQAKNALESYCFSM 429 R++ VH++ D +QR+R + + + R+ DDK + + +N + + Sbjct: 590 RHKRVHKKRSSDEKFQRKRRAAEEEQK---------RSYDDKGADNKELENLFSA--INS 638 Query: 428 KSTMEDEKLKEKISDSD 378 E EK++EK S D Sbjct: 639 PQEEEKEKIEEKRSPKD 655 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -2 Query: 308 EEYEHKQKELEGICNPIIRRCTRVP-EESPEVCRASRAEHPEPEVPPPGLEALA 150 E+Y + K + C PI + V EE CR +H E E+P ++ LA Sbjct: 309 EQYAIEGKTKKSYCAPIRHKARHVSMEEFQASCRLLN-QHSETEIPEDSIQDLA 361 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 27.9 bits (59), Expect = 8.7 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 7/64 (10%) Frame = -2 Query: 239 VPEESPEVCRASRAEHPEPEVPP----PGLEALAPPSRRSIKPTFHTT---RKPTCNNHL 81 VP ++P ++S A +P P+ PP A P ++ S PT + P+ H Sbjct: 789 VPTQAPTEMKSSTARNPPPKKPPNPTKQSATAPTPSTQGSQSPTGSASTLGENPSPTTHY 848 Query: 80 VTSP 69 T P Sbjct: 849 ATKP 852 >SB_49873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = -2 Query: 500 RNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCND 348 R++ D +K+ I ++ YC K T D D D LD+ +D Sbjct: 6 RSKIDAEKDGIHVPTTVQEYCVKAKPTKSDSDDFNDFYDDDYADDLDDDDD 56 >SB_48166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -3 Query: 712 CSVNS-SLTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITI 566 C+ N S T P P +P + + I + S EKST+ KITI Sbjct: 464 CTANGRSSTTRPQQPITLPATDANWPITDQPVNGTSEEEKSTSNRKKITI 513 >SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = -2 Query: 236 PEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTRK 102 P +P RA+ P+P V P A APP R P HT K Sbjct: 220 PRPAPARDRAASGPGPKPAVKPRDRLATAPPGR---PPAPHTREK 261 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -2 Query: 431 MKSTMEDEKLKEKISDSDKQTILDNCNDTIKW-LDSNQLADKEEYEHKQKELEG 273 +++ + EK K + D +++ L T+K+ LD +LA KE++ +KE EG Sbjct: 100 VENDRDSEKHKRDLRDKEQE--LSELRKTVKYALDQEKLA-KEQFGDLKKEFEG 150 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -2 Query: 176 PPPGLEALAPPSRRSIKPTFHTTRKPTCNNHLVTSP 69 PPP A PP R S P TR P N+ P Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 298 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/77 (22%), Positives = 39/77 (50%) Frame = -2 Query: 509 KKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLD 330 KK NE++++K+ + + + + EDEK ++K + +++ D+ K Sbjct: 1892 KKEENEEEEKKKKKKENEEEDDKKNNKEENEEDEKKEKKKKEENEEE--DDKKKKTKKKK 1949 Query: 329 SNQLADKEEYEHKQKEL 279 + ++EE E ++KE+ Sbjct: 1950 KKEEEEQEEDERRRKEI 1966 >SB_12881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 914 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 428 KSTMEDEKLKEKISDSDKQTILDNCNDT 345 +S EDEK+ SDS+ + LD+C+ T Sbjct: 257 RSASEDEKISLHFSDSEGSSSLDHCSLT 284 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -2 Query: 176 PPPGLEALAPPSRRSIKPTFHTTRKPTCNNHLVTSP 69 PPP A PP R S P TR P N+ P Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 210 >SB_10182| Best HMM Match : Transformer (HMM E-Value=9.9) Length = 245 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = -2 Query: 614 RFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETI 468 R R + H++ ++D R R + RD+ G + R++DD+Q++ + Sbjct: 92 RERDEDGHRKRDRDRRDDRDRRGERNRDKDKDHRGDRKRSDDDRQEKRL 140 >SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 27.9 bits (59), Expect = 8.7 Identities = 43/173 (24%), Positives = 72/173 (41%), Gaps = 10/173 (5%) Frame = -2 Query: 629 QRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GKKYRNEDDKQKETIQAKNAL 450 ++ P+R + R+ E+ +RQ L+ RD+AY K + + K+ + Sbjct: 294 EKSPEREKDRDRDLDEEELAEKRRQERKLRERDQAYYERLKVWEQRERKKAREYDREQEK 353 Query: 449 ESYCFSMKSTMEDEKLKEKISDSDKQTILDNCNDTIKWLDSNQL--------ADKEEYEH 294 E + E + L E + D D DN +D K+ S+ + A+ E E Sbjct: 354 EQE-IKDEQARERKHLLEFLEDYD-----DNRDDP-KYYKSSSMNRRRRDREAEMESDER 406 Query: 293 -KQKELEGICNPIIRRCTRVP-EESPEVCRASRAEHPEPEVPPPGLEALAPPS 141 +Q+ELE I I +R +P E+ E + SR E E G + P+ Sbjct: 407 DRQRELEEI-EEIRKRLVDMPAEDDNEPMQVSRESEREEEDSSDGFKPKLQPT 458 >SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) Length = 404 Score = 27.9 bits (59), Expect = 8.7 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 5/70 (7%) Frame = -2 Query: 278 EGICNPIIR-RCTRVPEESPEVCRASRAE-HP---EPEVPPPGLEALAPPSRRSIKPTFH 114 E + P +R R VPE + + AE HP P P P E+LAP + + Sbjct: 283 EEVAAPNLRKRHVFVPETDDDSPSPTNAEQHPCQTSPATPQPAKESLAPATIEEVPHQSG 342 Query: 113 TTRKPTCNNH 84 T++ +NH Sbjct: 343 TSQAAPIDNH 352 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = -2 Query: 191 PEPEVPPPGLE-ALAPPSRRSIKPTFH 114 P P PPP L A APP R P H Sbjct: 425 PPPPPPPPALRLACAPPRLRFTSPVLH 451 >SB_2761| Best HMM Match : zf-TRAF (HMM E-Value=0.26) Length = 436 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -2 Query: 668 WRASN*GHLRHRCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQ 540 WR N GH++ R Q P +Y+ + + + H QR L+ Sbjct: 246 WRRQNHGHIQSRTQVQPSSQQYKTLPSE-QSSPHKMSQREPLK 287 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,593,733 Number of Sequences: 59808 Number of extensions: 423324 Number of successful extensions: 2311 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 1928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2263 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -