BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30267 (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g63470.1 68416.m07147 serine carboxypeptidase, putative simil... 29 3.2 At4g29920.1 68417.m04257 heat shock protein-related contains sim... 28 7.3 >At3g63470.1 68416.m07147 serine carboxypeptidase, putative similar to SP|P52711 Serine carboxypeptidase II-3 precursor (EC 3.4.16.6) Hordeum vulgare; contains Pfam profile PF0450 serine carboxypeptidase Length = 502 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 680 ATDLIPKWNPCSALLKKSPIMS*WRNGDTTMLP 582 AT L +W PCS+++KK W + TT++P Sbjct: 374 ATKLPYEWQPCSSVIKK------WNDSPTTVIP 400 >At4g29920.1 68417.m04257 heat shock protein-related contains similarity to heat shock protein 101 [Triticum aestivum] gi|6013196|gb|AAF01280 Length = 1017 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -1 Query: 662 KWNP-CSALLKKSPIMS*WR-NGDTTMLPG*LL 570 KWN C AL K P M+ WR +++LPG L+ Sbjct: 523 KWNRFCQALHHKKPSMTAWRAEQSSSVLPGSLM 555 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,173,973 Number of Sequences: 28952 Number of extensions: 322286 Number of successful extensions: 650 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 639 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -