BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30264 (705 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1093 + 23912303-23912467,23912671-23912801,23913079-239130... 32 0.39 >07_03_1093 + 23912303-23912467,23912671-23912801,23913079-23913087, 23913146-23913228,23914494-23914596,23915988-23916066, 23916174-23916274,23916371-23916479 Length = 259 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/73 (23%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = +3 Query: 489 SGGCCHFAKMMEKYS--KIPEEPKFPSSLKSVKKDLNGTRERVKNALQHEDEPVPHKREK 662 +GGC F + + + K+ + P++PSS+ ++ +G V ++ +E+ +PH + Sbjct: 170 TGGCDRFVNLWDGANRRKLFQFPRYPSSIAALSFSRDGRLLAVASSYTYEEGDIPHPPDA 229 Query: 663 AYWKLEKENPVPP 701 + + E V P Sbjct: 230 IFIRDVNEVQVKP 242 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,248,193 Number of Sequences: 37544 Number of extensions: 295684 Number of successful extensions: 860 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -