BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30263 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.8 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 3.2 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 7.3 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 7.3 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 7.3 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 7.3 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 7.3 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 7.3 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 7.3 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 7.3 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 9.6 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 106 NQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEA 228 N+I + W + D G AYHGD + E I ++A Sbjct: 911 NRIRNQRWIVNRDTSGATGPFAYHGDQWVGFEDIKSVRDKA 951 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.6 bits (46), Expect = 3.2 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 Query: 461 LPTYTFPRWRHRVRYW 508 L + FPRWR + W Sbjct: 648 LDKFFFPRWRQTLAMW 663 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 227 PPAASTCPAHPRRLGARHHGLCP 295 P A P HP A HGL P Sbjct: 46 PQVAPQYPQHPYAAPAPGHGLQP 68 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 227 PPAASTCPAHPRRLGARHHGLCP 295 P A P HP A HGL P Sbjct: 46 PQVAPQYPQHPYAAPAPGHGLQP 68 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 227 PPAASTCPAHPRRLGARHHGLCP 295 P A P HP A HGL P Sbjct: 46 PQVAPQYPQHPYAAPAPGHGLQP 68 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 227 PPAASTCPAHPRRLGARHHGLCP 295 P A P HP A HGL P Sbjct: 46 PQVAPQYPQHPYAAPAPGHGLQP 68 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 227 PPAASTCPAHPRRLGARHHGLCP 295 P A P HP A HGL P Sbjct: 46 PQVAPQYPQHPYAAPAPGHGLQP 68 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 227 PPAASTCPAHPRRLGARHHGLCP 295 P A P HP A HGL P Sbjct: 46 PQVAPQYPQHPYAAPAPGHGLQP 68 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 227 PPAASTCPAHPRRLGARHHGLCP 295 P A P HP A HGL P Sbjct: 46 PQVAPQYPQHPYAAPAPGHGLQP 68 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 227 PPAASTCPAHPRRLGARHHGLCP 295 P A P HP A HGL P Sbjct: 46 PQVAPQYPQHPYAAPAPGHGLQP 68 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 241 YVPRASSSTWSPA 279 Y A+SS WSPA Sbjct: 210 YTNSANSSIWSPA 222 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 449 LPTGLPTYTFPRWRHRVRYWT 511 L TGL T P+W++R + T Sbjct: 111 LGTGLLTSAGPKWQNRRKILT 131 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,107 Number of Sequences: 336 Number of extensions: 3417 Number of successful extensions: 18 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -