BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30260 (758 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 176 2e-44 SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 174 6e-44 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 172 3e-43 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 135 4e-32 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 5e-23 SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049) 99 4e-21 SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36) 83 2e-16 SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07) 66 4e-11 SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16) 47 2e-05 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_47390| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_11346| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5) 31 1.3 SB_41892| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) 30 2.3 SB_43375| Best HMM Match : Pneumo_att_G (HMM E-Value=3.6) 29 3.1 SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) 29 3.1 SB_12216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5) 29 3.1 SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) 29 3.1 SB_50521| Best HMM Match : MFS_1 (HMM E-Value=0.0026) 29 4.1 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_22011| Best HMM Match : Chordopox_G2 (HMM E-Value=1.7) 29 5.4 SB_40933| Best HMM Match : DUF548 (HMM E-Value=1.7) 28 7.2 SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3) 28 7.2 SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) 28 7.2 SB_25455| Best HMM Match : DUF948 (HMM E-Value=0.11) 28 7.2 SB_58733| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_46921| Best HMM Match : Endomucin (HMM E-Value=6.3) 28 9.5 SB_30631| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_15723| Best HMM Match : DUF1639 (HMM E-Value=1.7) 28 9.5 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 176 bits (428), Expect = 2e-44 Identities = 98/168 (58%), Positives = 122/168 (72%), Gaps = 4/168 (2%) Frame = +2 Query: 254 NVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 430 NVLIFDLGGGTFDVSILTI+DG +FEVKSTAGDTHLGGEDFDNR+VNHFV EFKRKYKKD Sbjct: 194 NVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKD 253 Query: 431 LATNKRALRRLRTACERAKRTLSSSTKRALR*ILSLRVLTSTRQLLVLASRS*TPICSGL 610 ++ N RA+RRLRTACERAKRTLSSST+ ++ + SL ++ +CS L Sbjct: 254 MSKNSRAMRRLRTACERAKRTLSSSTEASIE-VDSL--FEGIDFYTKISRARFEDLCSDL 310 Query: 611 PWSQWRSLSVMPRWIRL-KSTI--LYWWGGSTRIPKVQKLLQDFFNGK 745 S ++ + KS I + GGSTR+PK+QK+L+++F+GK Sbjct: 311 FLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGK 358 Score = 140 bits (339), Expect = 1e-33 Identities = 69/87 (79%), Positives = 77/87 (88%) Frame = +3 Query: 3 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNV 182 E KTF EE+SSMVL KMKETAEAYLG+ V +AVITVPAYFNDSQRQATKDAGTI+GLNV Sbjct: 110 ERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNV 169 Query: 183 LRIINEPTAAAIAYGLDKKGTGERMYL 263 LR+INEPTAAA+AYGLDK +GE+ L Sbjct: 170 LRVINEPTAAALAYGLDKSLSGEKNVL 196 Score = 89.0 bits (211), Expect = 4e-18 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = +1 Query: 508 KASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVG 687 +ASIE+DSLFEGIDFYT I+RARFE+L +DLF S ++PV K+L DAK K+ IH++VLVG Sbjct: 280 EASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVG 339 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 174 bits (424), Expect = 6e-44 Identities = 96/167 (57%), Positives = 116/167 (69%), Gaps = 3/167 (1%) Frame = +2 Query: 254 NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 433 NVLI+DLGGGTFDVS+LTIEDGIFEVKSTAGDTHLGGEDFDN+MV+HFV++FK+KYKKD+ Sbjct: 194 NVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDI 253 Query: 434 ATNKRALRRLRTACERAKRTLSSSTKRALR---*ILSLRVLTSTRQLLVLASRS*TPICS 604 NKRA+RRLRTACERAKRTLSSST+ ++ + TS + + Sbjct: 254 TPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKT 313 Query: 605 GLPWSQWRSLSVMPRWIRLKSTILYWWGGSTRIPKVQKLLQDFFNGK 745 P Q S +P I+ GGSTRIPK+QK+LQ+ F GK Sbjct: 314 TEPVEQAIRDSKIPGGKESIHDIVL-VGGSTRIPKIQKMLQELFGGK 359 Score = 145 bits (351), Expect = 4e-35 Identities = 72/87 (82%), Positives = 78/87 (89%) Frame = +3 Query: 3 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNV 182 E K+FFPEE+SSMVLTKMKETAEAYLG V +AV+TVPAYF+DSQRQATKDAGTI+GLNV Sbjct: 110 EKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFHDSQRQATKDAGTIAGLNV 169 Query: 183 LRIINEPTAAAIAYGLDKKGTGERMYL 263 LRIINEPTAAAIAYGLDKK ER L Sbjct: 170 LRIINEPTAAAIAYGLDKKVGVERNVL 196 Score = 95.9 bits (228), Expect = 3e-20 Identities = 47/62 (75%), Positives = 54/62 (87%), Gaps = 2/62 (3%) Frame = +1 Query: 508 KASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM--DKAQIHDIVL 681 +ASIEIDSLFEGIDFYTSITRARFEELN DLF+ T EPVE+++RD+K+ K IHDIVL Sbjct: 279 QASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVL 338 Query: 682 VG 687 VG Sbjct: 339 VG 340 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 172 bits (418), Expect = 3e-43 Identities = 99/174 (56%), Positives = 120/174 (68%), Gaps = 10/174 (5%) Frame = +2 Query: 254 NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 433 NVLIFDLGGGTFDVS+L+IEDGIFEVKST GDTHLGGEDFDN MV+ FV++FK+KYKKD+ Sbjct: 287 NVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDI 346 Query: 434 ATNKRALRRLRTACERAKRTLSSSTKRALR*ILSL-------RVLTSTR---QLLVLASR 583 NKRALRRLRTACERAKRTLSSST+ ++ I SL +T R L + Sbjct: 347 TPNKRALRRLRTACERAKRTLSSSTQASIE-IDSLYDGIDFYTSITRARFEEMNAHLFKK 405 Query: 584 S*TPICSGLPWSQWRSLSVMPRWIRLKSTILYWWGGSTRIPKVQKLLQDFFNGK 745 + P+ + S+ S + + + GGSTRIPK+Q LLQ+FFNGK Sbjct: 406 TLEPVEKAIKDSKLESKEKIDEIVMV--------GGSTRIPKIQSLLQNFFNGK 451 Score = 129 bits (311), Expect = 3e-30 Identities = 65/79 (82%), Positives = 69/79 (87%) Frame = +3 Query: 27 EVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPT 206 ++SSMVL KMKETAEAYLG V +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPT Sbjct: 211 QISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPT 270 Query: 207 AAAIAYGLDKKGTGERMYL 263 AAAIAYGLDKK ER L Sbjct: 271 AAAIAYGLDKKVGQERNVL 289 Score = 92.3 bits (219), Expect = 4e-19 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = +3 Query: 3 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAG 161 E KTFF EE+SSMVL KMKETAEAYLG V +AV+TVPAYFNDSQRQATKDAG Sbjct: 135 ETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAG 187 Score = 90.2 bits (214), Expect = 2e-18 Identities = 41/61 (67%), Positives = 56/61 (91%), Gaps = 1/61 (1%) Frame = +1 Query: 508 KASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMD-KAQIHDIVLV 684 +ASIEIDSL++GIDFYTSITRARFEE+NA LF+ T+EPVEK+++D+K++ K +I +IV+V Sbjct: 372 QASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMV 431 Query: 685 G 687 G Sbjct: 432 G 432 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 135 bits (326), Expect = 4e-32 Identities = 67/87 (77%), Positives = 76/87 (87%) Frame = +3 Query: 3 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNV 182 E KTF EE+S+MVLTKMKETAEAYLGK V +AV+TVPAYFND+QRQATKDAG I+GL V Sbjct: 808 EIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTV 867 Query: 183 LRIINEPTAAAIAYGLDKKGTGERMYL 263 +RIINEPTAAAIAYG+DKK GE+ L Sbjct: 868 MRIINEPTAAAIAYGMDKK-EGEKNIL 893 Score = 126 bits (303), Expect = 3e-29 Identities = 71/167 (42%), Positives = 107/167 (64%), Gaps = 3/167 (1%) Frame = +2 Query: 254 NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 433 N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD ++ HF++ +K+K K++ Sbjct: 891 NILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNI 950 Query: 434 ATNKRALRRLRTACERAKRTLSSSTKRALR*ILSLRVLTSTRQLLVLASRS*TPICSGLP 613 + RA+++LR E+AKR LS+ + + I S ++L A + + L Sbjct: 951 RKDNRAVQKLRREVEKAKRALSTQHQARVE-IESFFEGEDFSEMLTRARFE--ELNAKLF 1007 Query: 614 WSQWRSLSVMPRWIRLKSTILY---WWGGSTRIPKVQKLLQDFFNGK 745 S + + + LK + ++ GGSTRIPKVQ+L++DFF GK Sbjct: 1008 KSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGK 1054 Score = 85.8 bits (203), Expect = 3e-17 Identities = 40/70 (57%), Positives = 53/70 (75%) Frame = +1 Query: 478 EGKEDLVIVHKASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 657 + K L H+A +EI+S FEG DF +TRARFEELNA LF+ST++PV+K L DA + K Sbjct: 966 KAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKK 1025 Query: 658 AQIHDIVLVG 687 ++IH+IVLVG Sbjct: 1026 SEIHEIVLVG 1035 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 105 bits (251), Expect = 5e-23 Identities = 64/164 (39%), Positives = 95/164 (57%), Gaps = 4/164 (2%) Frame = +2 Query: 257 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 436 + ++DLGGGTFD+SIL I+ G+FEVK+T GDT+LGGEDFDN ++ + EFK++ DL+ Sbjct: 2 IAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLS 61 Query: 437 TNKRALRRLRTACERAKRTLSSSTKRALR*ILSLRVLTSTRQLLVLASRS--*TPICSGL 610 + AL+RLR A E+AK LSSS + + + + L + SRS + + + Sbjct: 62 KDSMALQRLREAAEKAKIELSSSVQTDINLPYITVDASGPKHLNMKLSRSKFESLVADLI 121 Query: 611 PWSQWRSLSVMPRWIRLKSTI--LYWWGGSTRIPKVQKLLQDFF 736 + + K I + GG TR+PKVQ+ +QD F Sbjct: 122 NRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF 165 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/49 (40%), Positives = 35/49 (71%) Frame = +1 Query: 562 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGWLHSYPQ 708 ++R++FE L ADL T+ P +K L+DA+++K +I D++LVG + P+ Sbjct: 108 LSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPK 156 >SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049) Length = 179 Score = 98.7 bits (235), Expect = 4e-21 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 24/107 (22%) Frame = +3 Query: 3 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLN- 179 E ++F PE++S++VL ++K AEA+LG+ V+ AVITVPA+FND+QRQATKDAGTI+GL+ Sbjct: 9 EKRSFAPEQISAVVLEQLKADAEAFLGQAVKRAVITVPAHFNDAQRQATKDAGTIAGLDV 68 Query: 180 -----------------------VLRIINEPTAAAIAYGLDKKGTGE 251 VLRIINEPTAAAIAYGLDK G+ Sbjct: 69 LSRTASERPPSRFRRRRPHGRSRVLRIINEPTAAAIAYGLDKARGGK 115 >SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36) Length = 437 Score = 83.4 bits (197), Expect = 2e-16 Identities = 53/171 (30%), Positives = 97/171 (56%), Gaps = 7/171 (4%) Frame = +2 Query: 254 NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 433 NV++ DLGGGT DVS+L I+ G+F + AG+ LGG+DF+ R + + +Q +++ + L Sbjct: 223 NVMVVDLGGGTLDVSLLNIQGGMFVTMAMAGNNRLGGQDFNARFMQYLLQLIHKRFNRQL 282 Query: 434 ATNKRALRRLRTACERAKRTLSSSTKRALR*ILSLRVLTSTRQLL----VLASRS*TPIC 601 T ++RLR E AK L+ + + ++ L L L+ ++++ ++ + I Sbjct: 283 -TCSEDIQRLRQEVEAAKINLTRTNEVTIK--LMLPSLSEGKKIVKFKETISRKMFETIN 339 Query: 602 SGLPWSQWRSLSVMPRWIRL-KSTI--LYWWGGSTRIPKVQKLLQDFFNGK 745 L + + + + L K + + GGSTR+PK+++L+Q+FF+GK Sbjct: 340 EDLFKKVLQPIRRVLAEVELPKEEVDEVVLVGGSTRVPKIRQLIQEFFDGK 390 Score = 81.8 bits (193), Expect = 5e-16 Identities = 42/84 (50%), Positives = 56/84 (66%), Gaps = 1/84 (1%) Frame = +3 Query: 21 PEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINE 200 PEE+ V+ K++ AE L TV AV++VPA F+ QR AT A +++G+ VLR+INE Sbjct: 146 PEEIGGYVIKKLRTMAERNLTTTVTKAVMSVPAEFDIKQRNATVKAASLAGITVLRVINE 205 Query: 201 PTAAAIAYGLDKK-GTGERMYLSL 269 PTAAA+AYGL KK G M + L Sbjct: 206 PTAAALAYGLHKKEGVANVMVVDL 229 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/58 (34%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = +1 Query: 523 IDSLFEG---IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVG 687 + SL EG + F +I+R FE +N DLF+ ++P+ + L + ++ K ++ ++VLVG Sbjct: 314 LPSLSEGKKIVKFKETISRKMFETINEDLFKKVLQPIRRVLAEVELPKEEVDEVVLVG 371 >SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 76.6 bits (180), Expect = 2e-14 Identities = 34/79 (43%), Positives = 54/79 (68%) Frame = +3 Query: 3 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNV 182 + + F PE+V +M+ T++K TAE L V + VI+VP+Y+ D QR+ DA +GLN Sbjct: 167 KQEVFSPEQVMAMLFTRLKTTAEIALKTKVTDCVISVPSYYTDRQRRCMLDASATAGLNC 226 Query: 183 LRIINEPTAAAIAYGLDKK 239 LR++N+ TA ++AYG+ K+ Sbjct: 227 LRLMNDTTAVSLAYGIYKQ 245 Score = 71.7 bits (168), Expect = 6e-13 Identities = 35/85 (41%), Positives = 52/85 (61%) Frame = +2 Query: 254 NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 433 NV+ D+G + V I G +V STA + +LGG DFD +V HF QEFK KYK D+ Sbjct: 254 NVVFVDIGHSSLQVCITAFLKGQLKVLSTAVEPNLGGRDFDYVLVEHFAQEFKTKYKIDV 313 Query: 434 ATNKRALRRLRTACERAKRTLSSST 508 ++ +A +L CE+ K+ +S++T Sbjct: 314 HSSIKAKIKLGAECEKLKKLMSANT 338 Score = 31.9 bits (69), Expect = 0.58 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = +1 Query: 517 IEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIV 678 I I+ E D + + RA+FEEL ADL + P+ +L A+ K + ++V Sbjct: 343 INIECFMEDKDVHGRMKRAQFEELAADLLKLVEAPLRSAL--AQSGKYSVKNVV 394 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 67.3 bits (157), Expect = 1e-11 Identities = 31/75 (41%), Positives = 47/75 (62%) Frame = +3 Query: 6 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNVL 185 D TF PEE+ M+L + E + +++ V+TVP +FN ++R+A A + GLNVL Sbjct: 77 DVTFTPEELMGMILNHSRFIGEQFADHPIKDVVLTVPPFFNQAERRALLRAAELVGLNVL 136 Query: 186 RIINEPTAAAIAYGL 230 +I+N TA A+ YGL Sbjct: 137 QIMNSNTAVALNYGL 151 Score = 48.0 bits (109), Expect = 8e-06 Identities = 22/56 (39%), Positives = 32/56 (57%) Frame = +1 Query: 520 EIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVG 687 +I+ +F+G DF +TR EE+ DLF PV ++L+ A M I +VLVG Sbjct: 267 QIEGVFDGKDFRVKVTREELEEMCQDLFDRVAGPVNRALKSASMTMNDIDSVVLVG 322 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +2 Query: 329 VKSTAGDTHLGGEDFDNRMVNHFVQEFKR--KYKKDLATNKRALRRLRTACERAKRTLSS 502 +K D LGG D R+ +H VQ FK+ K+K ++ + RA+ + R K+ LS+ Sbjct: 201 IKGIGFDRTLGGHAIDMRLRDHLVQLFKKNYKFKGEVTQSSRAMAKFYKEALRVKQVLSA 260 Query: 503 STK 511 + + Sbjct: 261 NNE 263 >SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07) Length = 592 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/89 (37%), Positives = 58/89 (65%), Gaps = 5/89 (5%) Frame = +2 Query: 251 TNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKR----- 415 + VL++ LGG + DV++L++ +G+++V +T D LGG +FD +++ +FKR Sbjct: 154 STVLVYRLGGASHDVTLLSVINGMYKVLATEYDGALGGRNFDEVLLDLLANDFKRQVLLW 213 Query: 416 KYKKDLATNKRALRRLRTACERAKRTLSS 502 K+K D TNKR+ +L+T+ E+ K LS+ Sbjct: 214 KWKIDPLTNKRSKTKLQTSAEQCKNILST 242 >SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16) Length = 212 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/49 (40%), Positives = 35/49 (71%) Frame = +1 Query: 562 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGWLHSYPQ 708 ++R++FE L ADL T+ P +K L+DA+++K +I D++LVG + P+ Sbjct: 53 LSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPK 101 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 686 GGSTRIPKVQKLLQDFF 736 GG TR+PKVQ+ +QD F Sbjct: 94 GGMTRMPKVQQTVQDIF 110 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 251 TNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 373 T+ LI D G+F VS E+GI ++ GD H+ G F Sbjct: 1427 TDTLITDNQDGSFGVSYTPFEEGIHDLAVKFGDDHIPGSPF 1467 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 269 DLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 373 D G GT VS + +E+G +++ D H+ G F Sbjct: 1526 DNGDGTCSVSYIPVEEGDYDIHIKFADEHIPGSPF 1560 >SB_47390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 32.3 bits (70), Expect = 0.44 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +2 Query: 686 GGSTRIPKVQKLLQDFFNGK 745 GG+TR PK+Q+LL+++F GK Sbjct: 47 GGATRTPKIQQLLKNYFVGK 66 >SB_11346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1706 Score = 32.3 bits (70), Expect = 0.44 Identities = 34/147 (23%), Positives = 65/147 (44%), Gaps = 6/147 (4%) Frame = +3 Query: 9 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV---PAYFNDSQRQATKDAGTISGLN 179 K E+ S + K +A ++ N V P + +++Q T + + G N Sbjct: 763 KALIAEQSSQAAASSKKLVMQAGKAVSLSNTVKPATPRPNILSRTKKQTTATSQQVPGSN 822 Query: 180 VLRIINEPTAAAIAYGLDKKGTGERMYLSLTSAAVPSTCPSLPSRMVSSR*NPPPATPTW 359 + + P A ++A KG+ ++ +T +T PS+ S + S+ P T Sbjct: 823 ---LASGPFAVSLALS---KGSMGQLSSGVTDPKEIATTPSVSSTVSSTTTQPKLGTSIH 876 Query: 360 EVRTL---TIAWSTTLSRSSRGNTKRT 431 E +TL T++ +T S+++R + RT Sbjct: 877 EKKTLGKVTVSGATPGSKAARASKPRT 903 >SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 394 LCPGVQEEIQKGPRYQQESS*AFAYCM*EGK 486 LCP ++ + GP +++E AFA C+ GK Sbjct: 169 LCPSPEQNGEPGPMFEREGGDAFANCVARGK 199 >SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5) Length = 634 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +2 Query: 257 VLIFDLGGGTFDVSILTIEDGIFEVK 334 V I+DLG GT++++IL E G++ ++ Sbjct: 319 VPIYDLGNGTYEMAILFHEPGVYSIR 344 >SB_41892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 385 GQPLCPGVQEEIQKGPRYQQESS*AFAYCM 474 G LCP ++ + GP +++E S AFA C+ Sbjct: 218 GYKLCPLPEQNGEPGPMFEREGSDAFANCV 247 >SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) Length = 600 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 263 IFDLGGGTFDVSILTIEDGIFEV 331 +FDLG G+++V L +E G++ V Sbjct: 311 VFDLGNGSYEVLFLVMEPGVYRV 333 >SB_43375| Best HMM Match : Pneumo_att_G (HMM E-Value=3.6) Length = 774 Score = 29.5 bits (63), Expect = 3.1 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +3 Query: 267 LTSAAVPSTCPSLPSRMVSSR*NPPPATPTWEVRTL-TIAWSTTLSRSS 410 L S+A +T P+LP +V+ R PPP+T ++ T+ T+ STT + S+ Sbjct: 97 LDSSATTTTTPTLP--IVTLR--PPPSTSVTQIVTMTTVTISTTTAMST 141 >SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) Length = 2726 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -2 Query: 730 ILQELLHLGDTSGATPPVQYRGFEPYPSWHHG 635 +L L H D S PP+ Y E P HHG Sbjct: 146 LLPPLNHGKDNSANLPPLIYNNIETLPQLHHG 177 >SB_12216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2992 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 660 SNPRYCTGGVAPLVSPRCRSSCKISLMGK 746 +NP C G V+P++SP R CK +L G+ Sbjct: 264 ANPPQC-GEVSPIISPSMRIYCKPALKGR 291 >SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5) Length = 452 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 394 LCPGVQEEIQKGPRYQQESS*AFAYCM*EGK 486 LCP ++ GP +++E S AFA C+ GK Sbjct: 206 LCPLPEQNGGPGPMFEREGSDAFANCVTRGK 236 >SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) Length = 647 Score = 29.5 bits (63), Expect = 3.1 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 336 PPPATPTWEVRTL-TIAWSTTLSRSSRGNTKRTSLPTREL 452 PPPA T E L T +W+ T S + R KRT LPT L Sbjct: 436 PPPAFQTDEPERLQTSSWTETASGTGREEFKRT-LPTAAL 474 >SB_50521| Best HMM Match : MFS_1 (HMM E-Value=0.0026) Length = 1080 Score = 29.1 bits (62), Expect = 4.1 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 10/79 (12%) Frame = +3 Query: 42 VLTKMKETAEAYLGKT----------VQNAVITVPAYFNDSQRQATKDAGTISGLNVLRI 191 V K T+E Y+G T + NA +T+P YF + +K G G+ + Sbjct: 994 VTRKDNNTSETYVGLTENSFKTRRNKIYNAPLTLPPYFWCHPSRKSKKDGAKEGMAM--A 1051 Query: 192 INEPTAAAIAYGLDKKGTG 248 +++ I+Y LD+K TG Sbjct: 1052 MSKERNQEISYKLDRKWTG 1070 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 270 TSAAVPSTCPSLPSRMVSSR*NPPPATP 353 T A P P++PSR +R PPP P Sbjct: 784 TKPATPRVPPNIPSRPPGARPTPPPPPP 811 >SB_22011| Best HMM Match : Chordopox_G2 (HMM E-Value=1.7) Length = 444 Score = 28.7 bits (61), Expect = 5.4 Identities = 20/75 (26%), Positives = 40/75 (53%) Frame = +1 Query: 484 KEDLVIVHKASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 663 +E+ ++ + ++SL E ++S A F+++ DL S+RDA + +A Sbjct: 360 REEQMLYYNTGEYLESLLE----WSSTKSAVFDQV-LDLGIFLTRKKLWSVRDAHLLEAW 414 Query: 664 IHDIVLVGWLHSYPQ 708 +HD++ VG++ PQ Sbjct: 415 LHDLIRVGYIPPSPQ 429 >SB_40933| Best HMM Match : DUF548 (HMM E-Value=1.7) Length = 682 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -2 Query: 562 LTCRSQYPQRENLSQCSLCGR*QGPLCPLTCSTQTPKSSLVGSEVLFVFPLELL 401 L CRS+ + N CS+ +CP + +T SS + + L V PLE + Sbjct: 75 LICRSRRYRHRNGHNCSISRNSSSEICPSCRALETSLSSCLAT--LLVRPLETI 126 >SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3) Length = 439 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 394 LCPGVQEEIQKGPRYQQESS*AFAYCM 474 LCP ++ + GP +++E S AFA C+ Sbjct: 107 LCPLPEQNGEPGPMFEREGSDAFANCV 133 >SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 533 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 394 LCPGVQEEIQKGPRYQQESS*AFAYCM 474 LCP ++ + GP +++E S AFA C+ Sbjct: 74 LCPLPEQNGEPGPMFEREGSDAFANCV 100 >SB_25455| Best HMM Match : DUF948 (HMM E-Value=0.11) Length = 260 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +1 Query: 523 IDSLFEGIDFYTSITRARFEELNAD--LFRSTMEPVEKSLRD 642 +DSL +DF T+ T A F +LN R T+ + SL + Sbjct: 168 LDSLAVRVDFTTNTTNALFTQLNTTDAAIRDTLSQINSSLSE 209 >SB_58733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2060 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 724 QELLHLGDTSGATPPVQYRGFEPYPSW 644 Q+L +LG + G P + + FEP SW Sbjct: 1530 QQLFYLGRSRGLAPLILTKPFEPVGSW 1556 >SB_46921| Best HMM Match : Endomucin (HMM E-Value=6.3) Length = 312 Score = 27.9 bits (59), Expect = 9.5 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +3 Query: 288 STCPSLPSRMVSSR*NPPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTSLPTREL 452 S CPSLP+ S TP + TI T + SS T TS PT ++ Sbjct: 46 SLCPSLPTSSTHSTSPTVQTTPAFTTSPATILPPTAKTTSS---TSSTSKPTEDV 97 >SB_30631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -3 Query: 339 VDFTSKIPSSMVRMDTSKVPPPRSKISTFVLQYPFCQDR 223 V TS++ V T VP P S++ ++ + C DR Sbjct: 28 VQATSEVTVVSVETQTDAVPKPNSELRQAIIAWATCDDR 66 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 678 TGGVAPLVSPRCRSSCKISLM 740 TGG++P+VSP RSS + L+ Sbjct: 2343 TGGLSPIVSPAVRSSIPVPLV 2363 >SB_15723| Best HMM Match : DUF1639 (HMM E-Value=1.7) Length = 153 Score = 27.9 bits (59), Expect = 9.5 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 7/58 (12%) Frame = -3 Query: 387 TMRLSKSSPPKWVSPAVDFTSKIPSSM-VRMDTSKVPP------PRSKISTFVLQYPF 235 T L +SSP P D+ SK P + +R + PP R++ S++V+Q PF Sbjct: 44 TQALKRSSPTSLSYPQKDWLSKKPKNQDIRTRKTPKPPKTPSTAKRARPSSYVMQGPF 101 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,628,110 Number of Sequences: 59808 Number of extensions: 567230 Number of successful extensions: 4419 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 4141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4413 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -