BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30259 (787 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 3.2 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 4.3 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.0 bits (47), Expect = 3.2 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 79 DDDGAGDEPNADQLCDGRPAD 141 DDDG D+ + + +G+PA+ Sbjct: 394 DDDGDDDDDDDVEAANGKPAE 414 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/30 (30%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 554 EPNQVP-QMVTITF*RCCEMLTTSIYMNQI 640 E N+ P + T+ + CC+ T+IY++++ Sbjct: 333 ERNRSPVRPATVQYDTCCQGRATAIYIDKV 362 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,021 Number of Sequences: 438 Number of extensions: 5076 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -