BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30255 (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) 156 1e-38 SB_22930| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_34753| Best HMM Match : WD40 (HMM E-Value=5.3e-20) 42 7e-04 SB_6741| Best HMM Match : WD40 (HMM E-Value=0) 40 0.002 SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) 40 0.002 SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_9416| Best HMM Match : WD40 (HMM E-Value=0) 37 0.019 SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) 37 0.019 SB_40185| Best HMM Match : WD40 (HMM E-Value=0) 36 0.033 SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) 35 0.075 SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28) 35 0.075 SB_38974| Best HMM Match : WD40 (HMM E-Value=1.1e-19) 35 0.075 SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) 34 0.100 SB_41590| Best HMM Match : WD40 (HMM E-Value=6.5e-13) 34 0.100 SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.100 SB_22898| Best HMM Match : WD40 (HMM E-Value=5.9e-26) 34 0.100 SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.100 SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.100 SB_27472| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.100 SB_23694| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.100 SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.100 SB_34680| Best HMM Match : WD40 (HMM E-Value=4.5e-07) 34 0.13 SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_762| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_59449| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_39225| Best HMM Match : NIF (HMM E-Value=0) 33 0.17 SB_36541| Best HMM Match : WD40 (HMM E-Value=0) 33 0.17 SB_14574| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_35277| Best HMM Match : WIF (HMM E-Value=9.8e-06) 33 0.23 SB_32323| Best HMM Match : WD40 (HMM E-Value=0) 33 0.23 SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30) 33 0.23 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 33 0.23 SB_7988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) 33 0.30 SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) 32 0.53 SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) 32 0.53 SB_56394| Best HMM Match : WD40 (HMM E-Value=6.2e-10) 31 0.70 SB_46905| Best HMM Match : WD40 (HMM E-Value=8.9e-12) 31 0.70 SB_41991| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_6241| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_43403| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_5139| Best HMM Match : WD40 (HMM E-Value=8.5e-27) 31 0.70 SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22) 31 1.2 SB_42943| Best HMM Match : WD40 (HMM E-Value=0) 31 1.2 SB_42279| Best HMM Match : WD40 (HMM E-Value=2.2e-10) 31 1.2 SB_3347| Best HMM Match : WD40 (HMM E-Value=0.053) 31 1.2 SB_34456| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 31 1.2 SB_23517| Best HMM Match : WD40 (HMM E-Value=0) 30 1.6 SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) 30 2.1 SB_27754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_22092| Best HMM Match : WD40 (HMM E-Value=7.2e-07) 30 2.1 SB_21841| Best HMM Match : WD40 (HMM E-Value=0.00078) 30 2.1 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 30 2.1 SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) 30 2.1 SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_2072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 29 2.8 SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42) 29 2.8 SB_32608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_26977| Best HMM Match : WD40 (HMM E-Value=1.9e-10) 29 3.7 SB_18848| Best HMM Match : WD40 (HMM E-Value=5.5e-07) 29 3.7 SB_18553| Best HMM Match : fn3 (HMM E-Value=0.25) 29 3.7 SB_2435| Best HMM Match : WD40 (HMM E-Value=4.1e-10) 29 3.7 SB_48919| Best HMM Match : Kelch_2 (HMM E-Value=0.91) 29 3.7 SB_53648| Best HMM Match : WD40 (HMM E-Value=1.2) 29 4.9 SB_46590| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_55359| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_51198| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_48871| Best HMM Match : WD40 (HMM E-Value=0.0073) 29 4.9 SB_11437| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_40413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_21791| Best HMM Match : V-set (HMM E-Value=1.4) 28 6.5 SB_20382| Best HMM Match : WD40 (HMM E-Value=1.7e-23) 28 6.5 SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) 28 6.5 SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) 28 6.5 SB_6631| Best HMM Match : SOCS_box (HMM E-Value=1.5e-10) 28 6.5 SB_5194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_57042| Best HMM Match : WD40 (HMM E-Value=4.9e-09) 28 6.5 SB_40171| Best HMM Match : WD40 (HMM E-Value=0.00071) 28 6.5 SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_22042| Best HMM Match : WD40 (HMM E-Value=6.1e-13) 28 6.5 SB_5414| Best HMM Match : WD40 (HMM E-Value=6.6e-15) 28 6.5 SB_3187| Best HMM Match : WD40 (HMM E-Value=2.2e-08) 28 6.5 SB_39685| Best HMM Match : ANTH (HMM E-Value=1.5e-11) 28 8.6 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_24230| Best HMM Match : RanGAP1_C (HMM E-Value=6.6) 28 8.6 SB_21111| Best HMM Match : WD40 (HMM E-Value=0.0047) 28 8.6 SB_19085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_59679| Best HMM Match : Lectin_C (HMM E-Value=5.3e-10) 28 8.6 SB_59664| Best HMM Match : WD40 (HMM E-Value=2e-12) 28 8.6 SB_58364| Best HMM Match : WD40 (HMM E-Value=2.8026e-45) 28 8.6 SB_39817| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_11923| Best HMM Match : Toxin_3 (HMM E-Value=0.32) 28 8.6 SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 156 bits (379), Expect = 1e-38 Identities = 79/152 (51%), Positives = 99/152 (65%) Frame = +3 Query: 258 SHLLALLGQALKWQQHQGLLPPGTTIDLFRGKAAIRDQEDDLCPTQLSKIIKFGQKSHVE 437 S LLALLGQALKWQQ+QG+LPPGTTID+FRGKAA+RD+E++ P+Q+SK IKFG KSH E Sbjct: 159 SRLLALLGQALKWQQYQGMLPPGTTIDVFRGKAAVRDEEEEKYPSQMSKTIKFGTKSHPE 218 Query: 438 CARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICVIRLMMSTCAWKKRC*AWLLRGIATH 617 CA FSPDGQYLVTGSVDG +EVWN K + + + + + Sbjct: 219 CAAFSPDGQYLVTGSVDGFIEVWNFTTGKIRKDLKYQAQENFMMMDETVLCLTFSRDSEM 278 Query: 618 WLLGLMMEKLRSGKCQRVKCNAKLDRAHSKGV 713 G K++ K Q +C + +RAHSKGV Sbjct: 279 LASGGQDGKIKVWKLQTGQCLRRFERAHSKGV 310 Score = 138 bits (335), Expect = 3e-33 Identities = 65/85 (76%), Positives = 76/85 (89%) Frame = +1 Query: 1 LMELYEQVVLELIELRELGAARSLLRQTHPCLLMKQHETDRYMHLENLLARSYFDPREAY 180 L++LYEQ+VLELIELRELGAARSLLRQT P +++KQ + DRY+HLEN+LA+SYFD REAY Sbjct: 73 LIDLYEQIVLELIELRELGAARSLLRQTDPMIMLKQQQADRYLHLENMLAKSYFDTREAY 132 Query: 181 GSGGGKERRRAAIAASLAGEVSVVP 255 GG KERRRAAIA +LAGEVSVVP Sbjct: 133 PEGGSKERRRAAIAQALAGEVSVVP 157 Score = 86.6 bits (205), Expect = 2e-17 Identities = 39/67 (58%), Positives = 50/67 (74%) Frame = +2 Query: 509 FTTGKIRKDLRYQAHDEYMCMEEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQRKT 688 FTTGKIRKDL+YQA + +M M+E VL L F+RDS+ LA+G DGKIKVWK+ TG+ R+ Sbjct: 243 FTTGKIRKDLKYQAQENFMMMDETVLCLTFSRDSEMLASGGQDGKIKVWKLQTGQCLRRF 302 Query: 689 GPSSLKG 709 + KG Sbjct: 303 ERAHSKG 309 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 593 AFARDSDTLAAGSNDGKIKVWKVSTGKVQR 682 AF+ D L GS DG I+VW +TGK+++ Sbjct: 221 AFSPDGQYLVTGSVDGFIEVWNFTTGKIRK 250 Score = 31.1 bits (67), Expect = 0.93 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQ 515 G S V F+ D ++++ S DG +++WN++ Sbjct: 347 GHTSFVNDVIFTADAHHIISASSDGTIKIWNIK 379 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 581 VLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQRKTGPS 697 V + F D+ + + S+DG IK+W + + + Q PS Sbjct: 352 VNDVIFTADAHHIISASSDGTIKIWNIKSTECQHTFKPS 390 >SB_22930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.7 bits (158), Expect = 9e-12 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +2 Query: 509 FTTGKIRKDLRYQAHDEYMCMEEAVLSLAFARDSDTLAAGSNDGKIK 649 FTTGKIRKDL+YQA + +M M+E VL L F+RDS+ LA+G DGK K Sbjct: 72 FTTGKIRKDLKYQAQENFMMMDETVLCLTFSRDSEMLASGGQDGKHK 118 >SB_34753| Best HMM Match : WD40 (HMM E-Value=5.3e-20) Length = 645 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/49 (32%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +3 Query: 396 LSKIIKF-GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRIC 539 L K++ + +K + +FSPDG++L GS D V+++ ++R K + +C Sbjct: 218 LEKVVGYKDRKEEISDIKFSPDGKFLAVGSHDNYVDIYTVKRGKRIGVC 266 >SB_6741| Best HMM Match : WD40 (HMM E-Value=0) Length = 714 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/51 (39%), Positives = 29/51 (56%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICVIRLMMSTCA 569 G V RFSP+ Q+L++GS D +W++ +K VR CV +L S A Sbjct: 96 GHTGAVRVCRFSPNSQFLISGSADETFIIWDVLLKKPVR-CVDKLESSVTA 145 Score = 35.1 bits (77), Expect = 0.057 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 423 KSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 +S V F+PDG +++TG+ +G + +W Q+ K + Sbjct: 140 ESSVTACAFTPDGLHIITGTSEGKLAIWEAQKGKFI 175 Score = 31.5 bits (68), Expect = 0.70 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 390 TQLSKIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQ 515 T+L++ G HV SP G + T S D + +WNL+ Sbjct: 45 TELAQSPLDGHNYHVNSCSVSPFGTLMATASTDSTLMLWNLE 86 Score = 31.1 bits (67), Expect = 0.93 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 569 MEEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGK 673 +E +V + AF D + G+++GK+ +W+ GK Sbjct: 139 LESSVTACAFTPDGLHIITGTSEGKLAIWEAQKGK 173 >SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) Length = 198 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/51 (39%), Positives = 29/51 (56%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICVIRLMMSTCA 569 G V RFSP+ Q+L++GS D +W++ +K VR CV +L S A Sbjct: 96 GHTGAVRVCRFSPNSQFLISGSADETFIIWDVLLKKPVR-CVDKLESSVTA 145 Score = 35.1 bits (77), Expect = 0.057 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 423 KSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 +S V F+PDG +++TG+ +G + +W Q+ K + Sbjct: 140 ESSVTACAFTPDGLHIITGTSEGKLAIWEAQKGKFI 175 Score = 31.5 bits (68), Expect = 0.70 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 390 TQLSKIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQ 515 T+L++ G HV SP G + T S D + +WNL+ Sbjct: 45 TELAQSPLDGHNYHVNSCSVSPFGTLMATASTDSTLMLWNLE 86 Score = 31.1 bits (67), Expect = 0.93 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 569 MEEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGK 673 +E +V + AF D + G+++GK+ +W+ GK Sbjct: 139 LESSVTACAFTPDGLHIITGTSEGKLAIWEAQKGK 173 >SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1649 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICV 542 G V C SPD ++ ++GS D +V++W+L+ K VR V Sbjct: 872 GHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLV 913 Score = 31.5 bits (68), Expect = 0.70 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 581 VLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQRK 685 +L +A D+ + G DG I+VW TGK K Sbjct: 709 ILGIAVTPDTKKIITGGADGSIRVWDYETGKELNK 743 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQ 515 G HV + DG+ LV+ S D + +WNL+ Sbjct: 830 GHDGHVRGIAITSDGRRLVSASQDRTLRIWNLE 862 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNL 512 G V SPDG +V+GS D ++W + Sbjct: 956 GHSESVRIVTVSPDGLTIVSGSEDATFKIWRI 987 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWN 509 G K + S +G + VTGS D +V+VW+ Sbjct: 998 GHKRTINGIALSKNGDFCVTGSDDSLVKVWD 1028 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 450 SPDGQYLVTGSVDGVVEVWNLQREKSV 530 +PD + ++TG DG + VW+ + K + Sbjct: 715 TPDTKKIITGGADGSIRVWDYETGKEL 741 >SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = +3 Query: 432 VECARFSPDGQYLVTGSVDGVVEVWN 509 V CA+FSPDG+ +V+GS D +++W+ Sbjct: 73 VRCAKFSPDGRLIVSGSDDKTIKLWD 98 Score = 31.5 bits (68), Expect = 0.70 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +3 Query: 423 KSHVECAR---FSPDGQYLVTGSVDGVVEVWNLQREK 524 K+H R FS DGQ L+T S D ++VW + R+K Sbjct: 25 KAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQK 61 >SB_9416| Best HMM Match : WD40 (HMM E-Value=0) Length = 700 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +3 Query: 387 PTQLSKIIKF-GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRI 536 P K++K G +V+ DGQ ++GS DG V +W+L +++ V + Sbjct: 198 PRSCEKVMKLKGHMDNVKAVVIDSDGQQCLSGSSDGTVRLWSLGQQRCVAV 248 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWN 509 GQK + +P G L++GS + ++ VW+ Sbjct: 167 GQKDSIYSLAMNPAGTVLISGSTEKILRVWD 197 >SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) Length = 292 Score = 36.7 bits (81), Expect = 0.019 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = +3 Query: 369 QEDDLCPTQLSKIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWNL 512 Q D PTQL + + G + V ++SPD Q+L +G D + VWNL Sbjct: 129 QRDTRSPTQLERRL-VGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNL 175 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 390 TQLSKIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWNL 512 TQ++K+ G V SPDG+ +VTG+ D + WN+ Sbjct: 233 TQVAKLT--GHSFRVLYLAVSPDGEAIVTGAGDETLRFWNV 271 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 575 EAVLSLAFARDSDTLAAGSNDGKIKVWKVS 664 + V L ++ D LA+G ND K+ VW +S Sbjct: 147 QEVCGLKWSPDHQHLASGGNDNKLLVWNLS 176 >SB_40185| Best HMM Match : WD40 (HMM E-Value=0) Length = 503 Score = 35.9 bits (79), Expect = 0.033 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRI 536 G S V F P+ Y+ TGS D V +W++Q SVR+ Sbjct: 165 GHVSDVNKVAFHPNCNYIATGSSDRTVRLWDIQTGSSVRL 204 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 575 EAVLSLAFARDSDTLAAGSNDGKIKVWKVS 664 + V SL F+RD LA+ D IK+W S Sbjct: 312 DTVYSLCFSRDGTILASAGLDNCIKLWNTS 341 >SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 35.9 bits (79), Expect = 0.033 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 435 ECARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 +CA FS D QYLVT S D + +WN++ + VR Sbjct: 246 DCA-FSEDSQYLVTASSDNLARLWNVEAGEVVR 277 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQRE 521 G +V F DG+++ TG D +W+L+++ Sbjct: 80 GVSKNVTAVGFHEDGKWMFTGGEDSSARIWDLRKQ 114 >SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) Length = 1487 Score = 34.7 bits (76), Expect = 0.075 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 447 FSPDGQYLVTGSVDGVVEVWN 509 +SPDG Y+ TG DG V++WN Sbjct: 1259 YSPDGNYIATGGDDGKVKLWN 1279 Score = 34.3 bits (75), Expect = 0.100 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 590 LAFARDSDTLAAGSNDGKIKVWKVSTG 670 LA++ D + +A G +DGK+K+W TG Sbjct: 1257 LAYSPDGNYIATGGDDGKVKLWNTMTG 1283 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 432 VECARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 V FSP+GQ +++ S+DG V ++L R ++ R Sbjct: 1296 VTAVTFSPNGQVVLSASLDGTVRAFDLNRYRNFR 1329 Score = 31.5 bits (68), Expect = 0.70 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 572 EEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQRKT 688 E V SLAF+ L +G+ D +++W V KV R+T Sbjct: 1379 EAPVSSLAFSPSHPVLISGAWDKTVRLWNVFESKVSRET 1417 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 G ++ V FSP L++G+ D V +WN+ K R Sbjct: 1377 GHEAPVSSLAFSPSHPVLISGAWDKTVRLWNVFESKVSR 1415 >SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1483 Score = 34.7 bits (76), Expect = 0.075 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 444 RFSPDGQYLVTGSVDGVVEVWNLQR 518 RFSPDG+YL GS D VV+ + +++ Sbjct: 1220 RFSPDGKYLAVGSEDNVVDFYEMRK 1244 Score = 33.1 bits (72), Expect = 0.23 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +3 Query: 396 LSKIIKFGQKSHV-ECARFSPDGQYLVTGSVDGVVEVWNL-QREKSVRIC 539 LS++ + + V ++SPDGQ+L GS D V+++ + Q+ K V C Sbjct: 169 LSEVTRINDRKEVLHEMKYSPDGQFLAVGSNDNFVDIYAVAQKYKKVGEC 218 >SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28) Length = 539 Score = 34.7 bits (76), Expect = 0.075 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 G + + FSPDG++L++ S+D + W+L + V Sbjct: 451 GHANRITDVSFSPDGRWLISSSMDSTIRTWDLPAARHV 488 >SB_38974| Best HMM Match : WD40 (HMM E-Value=1.1e-19) Length = 584 Score = 34.7 bits (76), Expect = 0.075 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +3 Query: 438 CARFSPDGQYLVTGSVDGVVEVWN 509 C +SPDG+Y+VTG D ++ VW+ Sbjct: 321 CVCWSPDGKYVVTGGEDDLITVWS 344 >SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) Length = 256 Score = 34.3 bits (75), Expect = 0.100 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRI 536 G + FSPDG L +G +DG V VW+ + ++ + Sbjct: 179 GHTDTIHTMSFSPDGTLLASGGMDGAVRVWDFGQVRNTTL 218 >SB_41590| Best HMM Match : WD40 (HMM E-Value=6.5e-13) Length = 242 Score = 34.3 bits (75), Expect = 0.100 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 402 KIIKFGQK---SHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRI 536 KII+F S + F P + LVTG+ DG V++WN +R+ Sbjct: 21 KIIQFSNAHDDSEITAMSFDPSKRRLVTGARDGSVKIWNFNNGACLRV 68 >SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 34.3 bits (75), Expect = 0.100 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 3/31 (9%) Frame = +3 Query: 423 KSHVECA---RFSPDGQYLVTGSVDGVVEVW 506 K H +C RFSPDG+++++G DG +V+ Sbjct: 177 KGHTDCVNHLRFSPDGRWIISGGEDGAAKVY 207 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREK 524 G S VEC +F+ +V GS G +++W+L+ K Sbjct: 59 GHTSPVECVQFNSGEDLVVAGSQSGTLKIWDLEAAK 94 >SB_22898| Best HMM Match : WD40 (HMM E-Value=5.9e-26) Length = 490 Score = 34.3 bits (75), Expect = 0.100 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 572 EEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGK 673 +++V F+ DS +A+G G IKVW STG+ Sbjct: 122 KDSVTHTGFSHDSKLVASGDMSGMIKVWNASTGQ 155 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 438 CARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 C F DG + G DG ++VW+L++ ++ Sbjct: 208 CGMFMKDGARAIAGYEDGTLKVWDLKKGSNI 238 >SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 34.3 bits (75), Expect = 0.100 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 354 AAIRDQEDDLCPTQLSKIIKFGQK-SHVECARFSPDGQYLVTGSVDGVVEVWNLQR 518 A I+++ED++ + + + V C R+S +G+YL +G D ++ +W + R Sbjct: 2 APIKNEEDEMNENVPKLLCQMDNHLACVNCVRWSGNGKYLASGGDDNLIMIWQMAR 57 Score = 33.9 bits (74), Expect = 0.13 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 447 FSPDGQYLVTGSVDGVVEVWNLQR 518 +SPD +L +GSVD V +WN Q+ Sbjct: 96 WSPDDSFLASGSVDNTVTIWNAQK 119 >SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 644 Score = 34.3 bits (75), Expect = 0.100 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +3 Query: 387 PTQLSKIIKFGQKSHV-ECARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 P + SKI+K G HV C +FS G +V+GS DG ++VW+ K +R Sbjct: 307 PLRPSKILK-GHDDHVITCLQFS--GSRVVSGSDDGTLKVWSALSGKCLR 353 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +3 Query: 423 KSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 +S V C +FS ++++T S DG V++W+LQ + +R Sbjct: 562 QSAVTCLQFS--SKFVITSSDDGTVKIWDLQTGEFIR 596 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/31 (35%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +2 Query: 608 SDTLAAGSNDGKIKVWKVSTGK-VQRKTGPS 697 ++TL +G+ D +K+W ++TG+ +Q GP+ Sbjct: 529 NNTLVSGNADSTVKIWDITTGQCLQTLAGPN 559 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +2 Query: 518 GKIRKDLRYQAHDEYMCMEEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQR 682 G +R + HD+++ + L F+ + +GS+DG +KVW +GK R Sbjct: 306 GPLRPSKILKGHDDHV-----ITCLQFS--GSRVVSGSDDGTLKVWSALSGKCLR 353 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 G + V C ++ DG +V+G+ D +V+VW+ + E+ + Sbjct: 437 GHLAAVRCVKY--DGHRVVSGAYDFLVKVWDPETEQCI 472 >SB_27472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 34.3 bits (75), Expect = 0.100 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +3 Query: 447 FSPDGQYLVTGSVDGVVEVWNLQREK 524 FSPDG Y+++G DG + +W+ + K Sbjct: 10 FSPDGSYVISGDADGKLNIWDWKSTK 35 >SB_23694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 34.3 bits (75), Expect = 0.100 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Frame = +3 Query: 378 DLCPTQLSKIIKF-GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICVIRLM 554 DL P ++ + + G V C P GQ+L TGS D V+ W + + + + Sbjct: 17 DLQPFPTTEALVYEGHSGMVRCVTVDPTGQWLATGSDDKSVKFWEVATGRCTKTVTLDRS 76 Query: 555 MSTCAW 572 + + W Sbjct: 77 IQSIDW 82 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 617 LAAGSNDGKIKVWKVSTGK 673 LA GS+D +K W+V+TG+ Sbjct: 48 LATGSDDKSVKFWEVATGR 66 >SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 459 Score = 34.3 bits (75), Expect = 0.100 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 447 FSPDGQYLVTGSVDGVVEVWNLQ 515 FSPDG+YL +GS D V +W+ Q Sbjct: 341 FSPDGRYLASGSFDKRVHIWSTQ 363 >SB_34680| Best HMM Match : WD40 (HMM E-Value=4.5e-07) Length = 454 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 420 QKSHVECARFSPDGQYLVTGSVDGVVEVWNL 512 Q + + C FS QYL G DGVV +W+L Sbjct: 383 QSAIIHCIAFSNSCQYLAAGYNDGVVRIWSL 413 Score = 31.5 bits (68), Expect = 0.70 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 548 AHDEYMCMEEAVLSLAFARDSDTLAAGSNDGKIKVWKV 661 A +E M + +AF+ LAAG NDG +++W + Sbjct: 376 APNEGMIQSAIIHCIAFSNSCQYLAAGYNDGVVRIWSL 413 >SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 590 LAFARDSDTLAAGSNDGKIKVWKVSTGKVQRKTG 691 +AF LA SNDG +++++V++GKV + TG Sbjct: 355 VAFDPSGTVLAIASNDGSVQMYEVASGKVNQLTG 388 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 572 EEAVLSLAFARDSDTLAAGSNDGKIKVW 655 E+AV S+ F R + L + +DG +++W Sbjct: 390 EDAVQSVLFDRAGEFLLSSGSDGTVRIW 417 >SB_762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 33.9 bits (74), Expect = 0.13 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 447 FSPDGQYLVTGSVDGVVEVWNLQREK 524 +SPDG Y+ G++DG++ +++L K Sbjct: 114 YSPDGHYIACGAIDGIINIFDLTTNK 139 Score = 31.1 bits (67), Expect = 0.93 Identities = 16/61 (26%), Positives = 31/61 (50%) Frame = +3 Query: 378 DLCPTQLSKIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICVIRLMM 557 DL +L ++ G + FSPD Q L+T S DG ++++++ K + V ++ Sbjct: 134 DLTTNKLLHTLE-GHAMPIRSLTFSPDSQLLITASDDGHIKMYDVYPSKQLLFIVCNKLL 192 Query: 558 S 560 + Sbjct: 193 T 193 >SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = +3 Query: 366 DQEDDLCPTQLSKIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKS 527 D+ D+L +SK+++ G V +SPDG L++GSVD +W+ + K+ Sbjct: 162 DENDNLETWTVSKMLR-GHIEDVYDLAWSPDGTQLLSGSVDNSAIIWDAIKGKT 214 >SB_59449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 33.5 bits (73), Expect = 0.17 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +2 Query: 227 PSPGRCPSYLVPSASTTGPGPQMATAPGSAPS-RHHYRFVPW*SRNKRPRRRSLPHPT 397 PSP R S VP T G P P +A R R VP + +RP R +PHPT Sbjct: 125 PSPARSQSAPVPDP-TDGQRPSPRPVPDAADGQRQGPRPVPDPTDGQRPSPRPVPHPT 181 >SB_39225| Best HMM Match : NIF (HMM E-Value=0) Length = 1772 Score = 33.5 bits (73), Expect = 0.17 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +2 Query: 581 VLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQRKTGPSSL 703 V + F+ D LA GS D I++W V+TG V R GP +L Sbjct: 215 VSTCCFSSDEHMLATGSWDKNIQLWDVATG-VYRTQGPITL 254 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +3 Query: 420 QKSHVECARFSPDGQYLVTGS-VDGVVEVWNLQREKSVR 533 Q+ V FS DG+Y+V+G+ +D V VW+ + K ++ Sbjct: 121 QEGIVTTCHFSSDGKYVVSGNDLDYAVCVWDARDGKLIK 159 >SB_36541| Best HMM Match : WD40 (HMM E-Value=0) Length = 1070 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 581 VLSLAFARDSDTLAAGSNDGKIKVWKVSTGK 673 VL L+ + T+ +GSND +VW V+TGK Sbjct: 719 VLCLSVTSNDKTIVSGSNDFTARVWNVATGK 749 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +2 Query: 506 EFTTGKIRKDLRYQAHDEYMCMEEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKV 676 + ++GK+ KDL H AV+ + R + L + S DG +KVW V+ V Sbjct: 787 DISSGKLVKDLNAHTH--------AVMRIELLRAHNMLVSSSRDGTVKVWDVANAHV 835 Score = 31.9 bits (69), Expect = 0.53 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNL 512 G V C + DGQ +V+GS D V+ VW+L Sbjct: 377 GHSKPVLCLQIINDGQAIVSGSEDKVLRVWDL 408 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 432 VECARFSPDGQYLVTGSVDGVVEVWNLQREK 524 V CA+ + DG +V+GS DG V + ++ R++ Sbjct: 635 VTCAQVTQDGTQVVSGSADGTVRLHSVLRDR 665 Score = 29.5 bits (63), Expect = 2.8 Identities = 8/38 (21%), Positives = 19/38 (50%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 G ++C + D +++VT D ++ +WN + + Sbjct: 212 GHTQRLDCVTVTRDDKFIVTSGGDSLINIWNTENHDCI 249 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVW 506 G S + C + DG+ +++GS D V++W Sbjct: 502 GHSSWISCVAMTTDGKTIISGSNDKNVKMW 531 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +3 Query: 402 KIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREK 524 K++ F + C + G +VTG D V WN + K Sbjct: 289 KVVSFESHVKITCLAVTLKGDCVVTGCADHVARSWNAKSGK 329 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQR 518 G ++C DG+ +V+G+ D ++VW+L R Sbjct: 418 GHGGLIKCLAAMHDGKRIVSGAKDNNIKVWDLVR 451 >SB_14574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 33.5 bits (73), Expect = 0.17 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +2 Query: 227 PSPGRCPSYLVPSASTTGPGPQMATAPGSAPS-RHHYRFVPW*SRNKRPRRRSLPHPT 397 PSP R S VP T G P P +A R R VP + +RP R +PHPT Sbjct: 2 PSPARSQSAPVPDP-TDGQRPSPRPVPDAADGQRQGPRPVPDPTDGQRPSPRPVPHPT 58 >SB_35277| Best HMM Match : WIF (HMM E-Value=9.8e-06) Length = 587 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 441 ARFSPDGQYLVTGSVDGVVEVWNLQ 515 A FS DGQYL+ GS D V +W Q Sbjct: 100 ASFSHDGQYLICGSEDHFVYIWRTQ 124 >SB_32323| Best HMM Match : WD40 (HMM E-Value=0) Length = 611 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQ--REKSV 530 G +V CA+F P +V+ S+D V VW++ R+K+V Sbjct: 133 GHNHYVMCAQFHPSEDMVVSASLDQTVRVWDISGLRKKTV 172 >SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30) Length = 685 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVW 506 G S V C SPDGQY+ + + D + +W Sbjct: 626 GHTSRVLCMAMSPDGQYVASAAADETLRLW 655 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 462 QYLVTGSVDGVVEVWNLQREKSVR 533 QYL G+ DG V++W+++ K VR Sbjct: 257 QYLAVGTHDGNVQLWDVEASKCVR 280 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 444 RFSPDGQYLVTGSVDGVVEVW 506 ++SPDG+ L +G D VV +W Sbjct: 478 KWSPDGKLLASGGNDNVVNIW 498 >SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) Length = 1066 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWN 509 G ++ C F P+ ++TGS DG V VW+ Sbjct: 125 GHAQNISCVGFHPELPIILTGSEDGTVRVWH 155 >SB_7988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVW 506 G S V C SPDGQY+ + + D + +W Sbjct: 9 GHTSRVLCMAMSPDGQYVASAAADETLRLW 38 >SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1803 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWN 509 G V C R SPDG + + S D + +WN Sbjct: 1221 GHAGAVTCVRVSPDGGVIASSSADKTIRLWN 1251 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +2 Query: 572 EEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKV 676 E+ V SLAF+++ L + + D K+KVW V +G + Sbjct: 1264 EDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNL 1298 Score = 32.3 bits (70), Expect = 0.40 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 G + FSP G+++++ S+D +VW + V Sbjct: 1632 GHDMFCQYTEFSPSGEFIISSSIDNTAQVWRFDTHRHV 1669 Score = 31.1 bits (67), Expect = 0.93 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNL 512 G +S + FSPD L + ++D + VW+L Sbjct: 1715 GHESEIRVVSFSPDDSLLASAALDQTIRVWDL 1746 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 402 KIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 KII G V P G Y+++GS D + VW+L V Sbjct: 218 KIIFIGHLKAVNTLAIYPFGSYIMSGSSDNTIRVWSLDMSDEV 260 >SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) Length = 1764 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 575 EAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKV 676 + V LA D + +GS DG +KVW + G + Sbjct: 1060 KGVYGLAVTADGSCVVSGSEDGSVKVWSANDGSI 1093 >SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) Length = 1197 Score = 31.9 bits (69), Expect = 0.53 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +2 Query: 182 AAEEARSGAALPSQRPSPGRCPSYLVPSASTTGPGPQMATAPGSAPS 322 AA + GAAL +PG PS +AS+T PG ++ PG+A S Sbjct: 997 AASSSTPGAALSR---TPGAAPSSTPGAASSTTPGAAPSSTPGAAMS 1040 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 182 AAEEARSGAALPSQRPSPGRCPSYLVPSASTTGPGPQMATAPGSAPSR 325 AA S AA PS +PG PS + S++ PG ++ PG+A SR Sbjct: 964 AATSPVSPAAAPST--TPGAAPSTTPGAESSSTPGAASSSTPGAALSR 1009 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 182 AAEEARSGAALPSQRPSPGRCPSYLVPSASTTGPGPQMATAPGSAPS 322 AA GAA PS +PG S + + S++ PG ++ PG+APS Sbjct: 1021 AASSTTPGAA-PSS--TPGAAMSSIPGATSSSTPGAASSSTPGAAPS 1064 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +2 Query: 188 EEARSGAALPSQRP--SPGRCPSYLVPSASTTGPGPQMATAPGSAPS 322 E AR+ P+ SP PS +A +T PG + ++ PG+A S Sbjct: 954 ENARTVPLTPAATSPVSPAAAPSTTPGAAPSTTPGAESSSTPGAASS 1000 >SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) Length = 844 Score = 31.9 bits (69), Expect = 0.53 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 G C SPDG L TG +D V W+L+ + ++ Sbjct: 467 GHTDGASCIDISPDGTKLWTGGLDNTVRSWDLREGRQLQ 505 >SB_56394| Best HMM Match : WD40 (HMM E-Value=6.2e-10) Length = 183 Score = 31.5 bits (68), Expect = 0.70 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWN 509 G + V C RF P G+ + +G D +++W+ Sbjct: 38 GHIADVNCCRFFPSGEVIASGGADFQIKIWS 68 >SB_46905| Best HMM Match : WD40 (HMM E-Value=8.9e-12) Length = 340 Score = 31.5 bits (68), Expect = 0.70 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 G V + DG L++GS D VW++Q +S+R Sbjct: 171 GHSKQVTSLAVTMDGTVLLSGSNDNTARVWHIQSRQSIR 209 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 581 VLSLAFARDSDTLAAGSNDGKIKVWKVST 667 V SLA D L +GSND +VW + + Sbjct: 176 VTSLAVTMDGTVLLSGSNDNTARVWHIQS 204 >SB_41991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 31.5 bits (68), Expect = 0.70 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +2 Query: 518 GKIRKDLRYQAHDEYMCMEEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTG 670 G R+ ++Y YM A+ +AF L +G DG++++W + G Sbjct: 87 GTSRQGMQYSNSTSYMGTT-AITCMAFDSTERRLISGGRDGRLRIWNYNNG 136 >SB_6241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 933 Score = 31.5 bits (68), Expect = 0.70 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 206 AALPSQRPSPGRCPSYLVPSASTTG--PGPQMATAPGSAPSRHH 331 A P Q P+PGR PSY + S T P P + P +H Sbjct: 678 AGFPRQLPTPGRTPSYPETAISRTAAIPPPDFTSTPALEQVNNH 721 >SB_43403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 31.5 bits (68), Expect = 0.70 Identities = 9/34 (26%), Positives = 23/34 (67%) Frame = +3 Query: 432 VECARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 V +FSP+G+Y++ ++D +++W+ + K ++ Sbjct: 125 VSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLK 158 >SB_5139| Best HMM Match : WD40 (HMM E-Value=8.5e-27) Length = 855 Score = 31.5 bits (68), Expect = 0.70 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 393 QLSKIIKFGQKSHVECARFSPDGQYLVTGSV--DGVVEVWNLQRE 521 Q+S+++ G K V C F+PD +++V+ D +V +WNL+ E Sbjct: 196 QISEMVN-GHKHGVACVAFAPDLKHVVSAGFQHDLLVNMWNLKDE 239 >SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22) Length = 453 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 575 EAVLSLAF-ARDSDTLAAGSNDGKIKVWKVST 667 E + F A D+D LA S DG +KVW V T Sbjct: 370 ETIFDCKFKADDADMLATASFDGTVKVWDVDT 401 >SB_42943| Best HMM Match : WD40 (HMM E-Value=0) Length = 273 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +3 Query: 351 KAAIRDQEDDLCPTQL-SKIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREK 524 K I+++ + P QL S+ ++ C SPDG +G DG +W+L K Sbjct: 176 KYTIQEETHSVEPDQLPSEDQPHWPPGYLNCVTVSPDGSLCASGGKDGQAMLWDLNDGK 234 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 581 VLSLAFARDSDTLAAGSNDGKIKVW 655 VLS+AF+ D+ + +G+ D IK+W Sbjct: 145 VLSVAFSADNRQIVSGARDHHIKLW 169 >SB_42279| Best HMM Match : WD40 (HMM E-Value=2.2e-10) Length = 291 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 575 EAVLSLAF-ARDSDTLAAGSNDGKIKVWKVST 667 E + F A D+D LA S DG +KVW V T Sbjct: 208 ETIFDCKFKADDADMLATASFDGTVKVWDVDT 239 >SB_3347| Best HMM Match : WD40 (HMM E-Value=0.053) Length = 321 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 569 MEEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQRKTGPSS 700 ME AF + LA + DG++KVW + G ++ + PSS Sbjct: 1 MEATKCPCAFDNNGRFLALLTPDGRLKVWDCTNGSLKNQYTPSS 44 >SB_34456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVW 506 G V+ +SP+G+Y+ + S DG V +W Sbjct: 86 GHDDRVKSCAWSPNGEYVASSSADGRVTLW 115 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 602 RDSDTLAAGSNDGKIKVWKVSTGKV 676 R D L +G++DG +K+W + + V Sbjct: 55 RTGDILCSGADDGSLKLWDIRSNSV 79 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 429 HVECARFSPDGQYLVTGSVDGVVEVWNLQREK 524 HV+ +F+ G+ ++GS DG +W +R K Sbjct: 56 HVDSIQFNHTGEKFLSGSRDGTARIWFFKRSK 87 >SB_23517| Best HMM Match : WD40 (HMM E-Value=0) Length = 860 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 581 VLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQRK 685 VL A DS +A+ S D + +W VSTG+V R+ Sbjct: 616 VLDAVAAGDSSRIASCSADRTVVLWDVSTGQVIRR 650 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWN 509 G + V RF+ DG Y +T D ++ +WN Sbjct: 569 GHQGAVRAVRFNSDGNYCLTCGSDKILALWN 599 >SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 30.3 bits (65), Expect = 1.6 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = +3 Query: 444 RFSPDGQYLVTGSVDGVVEVWN 509 ++SPDG+YL +G D ++ +W+ Sbjct: 298 KWSPDGKYLASGGNDNLLNIWD 319 >SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 G K + + DG+YL +G D ++ +W+ K + Sbjct: 112 GHKEQILALAITTDGKYLASGGKDKLIRIWDPDTSKHI 149 >SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +3 Query: 438 CARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 C F DGQ ++ G DG++++++L +R Sbjct: 86 CGTFRSDGQLMIAGGEDGLIQLFDLNSRAVLR 117 >SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) Length = 1207 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -2 Query: 620 PMCRYPSQKPGSAPLLPCT-CTHH 552 P CRYP +K G P + CT C H Sbjct: 828 PACRYPVEKNGGCPHMSCTMCGGH 851 >SB_27754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 572 EEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGK 673 E +LSL++ + L GS+D +KV+ +STG+ Sbjct: 124 EGRILSLSWHVSDNFLVTGSSDSMVKVYDLSTGR 157 >SB_22092| Best HMM Match : WD40 (HMM E-Value=7.2e-07) Length = 338 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +3 Query: 405 IIKFGQKSHVECARFSPDG--QYLVTGSVDGVVEVWNL 512 + +F H + DG YLVTG DG+++VW++ Sbjct: 48 LAEFLAHQHAGSLTMAVDGTNSYLVTGDADGLIKVWDI 85 >SB_21841| Best HMM Match : WD40 (HMM E-Value=0.00078) Length = 360 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 596 FARDSDTLAAGSNDGKIKVWKVSTGKVQRK 685 ++R+ L +GSND + VW + TG+ +K Sbjct: 59 WSRNGRKLLSGSNDWNVSVWDILTGECDQK 88 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 572 EEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGK 673 E +LSL++ + L GS+D +KV+ +STG+ Sbjct: 28 EGRILSLSWHVSDNFLVTGSSDSMVKVYDLSTGR 61 >SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) Length = 1049 Score = 29.9 bits (64), Expect = 2.1 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 4/93 (4%) Frame = +3 Query: 345 RGKAAIRDQEDDLCPTQLSKIIKFGQKSH---VECARFSPDGQYLVTGSVDGVVEVW-NL 512 +G+ + DD P + + K H V RFS G+ + + DG+V+VW N Sbjct: 727 KGRTSQPKNIDDCIPKPFIHLGQEEYKEHHAAVTHCRFSSSGRTIASADTDGIVKVWTNY 786 Query: 513 QREKSVRICVIRLMMSTCAWKKRC*AWLLRGIA 611 K+ + + + + W + LL G A Sbjct: 787 PDIKTCTTIMSKSPLLSLEWATKPDRLLLLGTA 819 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +3 Query: 426 SHVECARFSPDGQYLVTGSVDGVVEVWNL 512 S + C F+ +G LVTG+ DG++ ++++ Sbjct: 917 SCINCTGFNHNGTLLVTGATDGMIRLYDM 945 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +2 Query: 524 IRKDLRYQAHDEYMCMEEAVLSLAFARDSDTLAAGSNDGKIKVW 655 I K + +EY AV F+ T+A+ DG +KVW Sbjct: 740 IPKPFIHLGQEEYKEHHAAVTHCRFSSSGRTIASADTDGIVKVW 783 >SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1906 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 444 RFSPDGQYLVTGSVDGVVEVWNLQREKSVRICVIRLMMST 563 R SP QYL+ G++ VW + + C + M+T Sbjct: 1010 RMSPSLQYLMQAGPQGILRVWPIALTGQTKYCSFMVSMTT 1049 >SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 426 SHVECARFSPDGQY-LVTGSVDGVVEVWNLQREK 524 + V C F+P ++ L TGS D V +W+L+ K Sbjct: 322 AEVNCLSFNPYSEFILATGSADKTVALWDLRNLK 355 >SB_2072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 29.5 bits (63), Expect = 2.8 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQR 518 G + C DG++L+T S D +++W++++ Sbjct: 176 GHADGITCIASKGDGRHLITNSKDQTIKLWDIRK 209 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 432 VECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRIC 539 V FSPD + TG DG+V +W+ K V C Sbjct: 972 VRSISFSPDNM-ICTGCDDGIVRIWDSVSGKEVTSC 1006 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 560 YMCMEEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGK 673 YM + V F+ D +A+ S+D +++W+ S+G+ Sbjct: 632 YMAHTDIVRWCCFSPDGGKVASCSDDNTVRIWEASSGE 669 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 426 SHVECARFSPDGQYLVTGSVDGVVEVWNLQREK 524 S + FSP G+ + G G + V+NLQ + Sbjct: 843 SKIHSVTFSPRGEAIAVGCESGTISVFNLQEAR 875 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 587 SLAFARDSDTLAAGSNDGKIKVWKV 661 S+ ++DS L +GS D +K+W + Sbjct: 765 SVGISKDSSKLVSGSEDETVKIWTI 789 >SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42) Length = 383 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 572 EEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQR 682 ++A+L++ D TLA S D + +W ++TG++ R Sbjct: 51 KKAILNVEVGPDGKTLATCSADCTVGLWNITTGELLR 87 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICV 542 G K + PDG+ L T S D V +WN+ + +R V Sbjct: 49 GHKKAILNVEVGPDGKTLATCSADCTVGLWNITTGELLRTLV 90 >SB_32608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 909 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/50 (20%), Positives = 27/50 (54%) Frame = +3 Query: 360 IRDQEDDLCPTQLSKIIKFGQKSHVECARFSPDGQYLVTGSVDGVVEVWN 509 + ++ D + + ++ G +S V RF+P +++ V+ +++VW+ Sbjct: 133 LANEPDTMVSVDQAFMVLSGHRSIVNQVRFNPTTHMIISAGVEKIIKVWS 182 >SB_26977| Best HMM Match : WD40 (HMM E-Value=1.9e-10) Length = 345 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 408 IKFGQKSHVECARFSPDGQYLVTGSVDGVVEV 503 + +G + + C + SPDG + TGS D + + Sbjct: 298 VYYGHDNRISCLKVSPDGTGICTGSWDNTLRM 329 >SB_18848| Best HMM Match : WD40 (HMM E-Value=5.5e-07) Length = 508 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +2 Query: 560 YMCMEEAVLSLAFARD--SDTLAAGSNDGKIKVWKVSTGKVQR 682 Y E++ LA A D +D L +G + G+I VW +++ + R Sbjct: 56 YAASEDSASVLALATDPSNDILVSGDSAGRISVWDITSYCISR 98 >SB_18553| Best HMM Match : fn3 (HMM E-Value=0.25) Length = 1702 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/72 (26%), Positives = 34/72 (47%) Frame = +2 Query: 107 SMKQIGICILKTC*HVHISTLVRHTAAEEARSGAALPSQRPSPGRCPSYLVPSASTTGPG 286 +++ G+ + + V+++T V++ EA++GA L SQ S G P G Sbjct: 1185 ALRSAGLEMAGSAKRVNLTTGVKYFVTVEAKNGAGLLSQAWSNGFIVDDTPPELRDLTLG 1244 Query: 287 PQMATAPGSAPS 322 P++ PG S Sbjct: 1245 PRLWIRPGETLS 1256 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 283 WPSSASRWDEVRRTPPRRGTLRWQRGAAPCLLRCRM 176 W S S EV TPP GT+ + A C+ +C + Sbjct: 1323 WTSKTSSSVEVDLTPPIPGTITPSQAAIACISKCTL 1358 >SB_2435| Best HMM Match : WD40 (HMM E-Value=4.1e-10) Length = 1272 Score = 29.1 bits (62), Expect = 3.7 Identities = 21/80 (26%), Positives = 33/80 (41%), Gaps = 3/80 (3%) Frame = +3 Query: 306 QGLLPP--GTTIDLFRGKAAIR-DQEDDLCPTQLSKIIKFGQKSHVECARFSPDGQYLVT 476 QGL P T + F+ + D E C QL + + H DG+ LV Sbjct: 60 QGLFLPLSNTIVTCFKDDSIFAWDSESLQCKYQLPVPPEDAKTPHYRTLAVPRDGRLLVA 119 Query: 477 GSVDGVVEVWNLQREKSVRI 536 G + VW+L+ ++ + I Sbjct: 120 GGRSRFLHVWSLENKRLLHI 139 >SB_48919| Best HMM Match : Kelch_2 (HMM E-Value=0.91) Length = 198 Score = 29.1 bits (62), Expect = 3.7 Identities = 21/80 (26%), Positives = 33/80 (41%), Gaps = 3/80 (3%) Frame = +3 Query: 306 QGLLPP--GTTIDLFRGKAAIR-DQEDDLCPTQLSKIIKFGQKSHVECARFSPDGQYLVT 476 QGL P T + F+ + D E C QL + + H DG+ LV Sbjct: 52 QGLFLPLSNTIVTCFKDDSIFAWDSESLQCKYQLPVPPEDAKTPHYRTLAVPRDGRLLVA 111 Query: 477 GSVDGVVEVWNLQREKSVRI 536 G + VW+L+ ++ + I Sbjct: 112 GGRSRFLHVWSLENKRLLHI 131 >SB_53648| Best HMM Match : WD40 (HMM E-Value=1.2) Length = 88 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 456 DGQYLVTGSVDGVVEVWNLQ 515 DGQYL+ GS D V +W Q Sbjct: 3 DGQYLICGSEDHFVYIWRTQ 22 >SB_46590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 972 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +2 Query: 212 LPSQRPSPGRCPSYLVPSASTTGPGPQMATAPGSAPSRHHYRFVPW*SRNK 364 +PSQ SPG+ P ++P PG + PG P+ H + P NK Sbjct: 621 IPSQFLSPGQAPHMVLP------PGSPVQQVPGYQPAYLHTPYQPQYGLNK 665 >SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 447 FSPDGQYLVTGSVDGVVEVWNLQREKSVRI 536 F +GQY+V GS DG +W+ +R+ Sbjct: 657 FGDNGQYIVAGSDDGSFFMWDRNTTNLIRV 686 >SB_55359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2516 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = +3 Query: 420 QKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICVIRLMMSTCAWKKR 581 Q H + +FSP G YL G V G V +I+L S +W R Sbjct: 722 QNGH-DVLQFSPSGSYLSAGDVPGCVSDAETCNPGFTVSVIIKLDSSAASWTNR 774 >SB_51198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1627 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 456 DGQYLVTGSVDGVVEVWNLQREKSVRI 536 D + +VT S D +V VW+L+RE+S + Sbjct: 1163 DMKIIVTVSDDKLVRVWDLEREESANV 1189 >SB_48871| Best HMM Match : WD40 (HMM E-Value=0.0073) Length = 614 Score = 28.7 bits (61), Expect = 4.9 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +3 Query: 465 YLVTGSVDGVVEVWNL 512 YLVTG DG+++VW++ Sbjct: 70 YLVTGDADGLIKVWDI 85 >SB_11437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 10/42 (23%) Frame = +3 Query: 438 CARFSPDG----------QYLVTGSVDGVVEVWNLQREKSVR 533 CA+F PDG YL T + D VV++W+L++ K+ + Sbjct: 227 CAQFHPDGLIFGTGTSDRYYLATSADDSVVKLWDLRKLKNFK 268 >SB_40413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 608 SDTLAAGSNDGKIKVWKVSTGK 673 S+ LA G +DG IK+W S G+ Sbjct: 308 SNFLAVGYSDGNIKLWDTSNGR 329 >SB_21791| Best HMM Match : V-set (HMM E-Value=1.4) Length = 474 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVE 500 G+ + EC+ F+ DG+Y++ GS V E Sbjct: 126 GEHLNRECSLFTDDGRYVIVGSASYVPE 153 >SB_20382| Best HMM Match : WD40 (HMM E-Value=1.7e-23) Length = 437 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 414 FGQKSHVECARFSPDGQYLVTGSVDGVVEVWNL 512 +G K V S D +VTGS D +++W L Sbjct: 243 YGHKLPVMAMDISSDSTLIVTGSADKNIKIWGL 275 >SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) Length = 1093 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 447 FSPDGQYLVTGSVDGVVEVWNLQREK 524 FSPDG +++ S DG V V+N Q + Sbjct: 380 FSPDGTLVLSASADGRVYVYNEQSSR 405 >SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) Length = 208 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSV 530 G ++ + FSPDG+ + + + D V++WN + K + Sbjct: 57 GHQALINQVCFSPDGRLIASAAFDKSVKLWNGETGKFI 94 >SB_6631| Best HMM Match : SOCS_box (HMM E-Value=1.5e-10) Length = 330 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 581 VLSLAFARDSDTLAAGSNDGKIKVWKV 661 V LAF+R LAA +DG I++W++ Sbjct: 263 VYQLAFSRCQGKLAASYSDGFIRIWQL 289 >SB_5194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 581 VLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQRKTGPSSLKG 709 V S+ + LAAG +G ++V+ TGK +R SL G Sbjct: 48 VFSVHLSPRDQYLAAGCGNGAVQVYSCDTGKKRRPLKHGSLYG 90 >SB_57042| Best HMM Match : WD40 (HMM E-Value=4.9e-09) Length = 707 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 611 DTLAAGSNDGKIKVWKVSTGKVQR 682 D L G +DG + VW++ TG + R Sbjct: 518 DFLVVGCSDGSVYVWQMETGHLDR 541 >SB_40171| Best HMM Match : WD40 (HMM E-Value=0.00071) Length = 155 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 441 ARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICV 542 A SPD YL++GS D +W + +C+ Sbjct: 103 AALSPDDNYLLSGSSDNNAYIWKVSDADRPPVCL 136 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +2 Query: 572 EEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQRKTGP 694 +++V ++ F D+ ++AG+ DG +K+W + K P Sbjct: 3 QQSVTAVVFHGDNLLISAGAMDGNLKMWDLRKYYTMAKQDP 43 >SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 608 SDTLAAGSNDGKIKVWKVSTGKV 676 ++ + S G +KVW++STGK+ Sbjct: 1406 ANVIVTASGSGGVKVWELSTGKI 1428 >SB_22042| Best HMM Match : WD40 (HMM E-Value=6.1e-13) Length = 232 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNL 512 G + C DG +VTGS D V VW++ Sbjct: 174 GHSKMILCLDVCADGTKIVTGSKDHTVRVWDV 205 >SB_5414| Best HMM Match : WD40 (HMM E-Value=6.6e-15) Length = 490 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 441 ARFSPDGQYLVTGSVDGVVEVWNLQREKSVRICV 542 A SPD YL++GS D +W + +C+ Sbjct: 81 AALSPDDNYLLSGSSDNNAYIWKVSDADRPPVCL 114 >SB_3187| Best HMM Match : WD40 (HMM E-Value=2.2e-08) Length = 1259 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 426 SHVECARFSPDGQYLVTGSVDG 491 S V C +SPDG+ L +G DG Sbjct: 1209 SPVTCMEWSPDGELLYSGDTDG 1230 >SB_39685| Best HMM Match : ANTH (HMM E-Value=1.5e-11) Length = 523 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 176 HTAAEEARSGAALPSQRPSPG--RCPSYLVPSASTTGPGPQMATAP 307 +T+ + + A+ PSQ P P + P L AS P P AT+P Sbjct: 336 NTSVQLPKPQASQPSQVPRPQVPQAPQQLPWQASAPAPAPAKATSP 381 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 556 IMSLITQILTDFSRCKFQTSTTPSTEPVTKYCPSGENRAHSTW 428 ++S IT + +S + PS PV K C +GE R + W Sbjct: 263 LLSFITSCWS-YSVICMSCAVGPSCNPVEKSCENGEGRCVTAW 304 >SB_24230| Best HMM Match : RanGAP1_C (HMM E-Value=6.6) Length = 225 Score = 27.9 bits (59), Expect = 8.6 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = -3 Query: 190 LRCRMPHEGRNMNVLTGFQDAYTDLFHAASSTDKD-----VSDVARISQHPILAILSTP- 29 +R P+ RN+ ++ A + + D++ VSD +IS + A+L+TP Sbjct: 85 VRLSSPNPPRNVRMVNQATSATPLMQSPTEAADRNISALIVSDDVKISHESLGAVLATPL 144 Query: 28 --TQPAHIIPS 2 T+P H +P+ Sbjct: 145 VTTRPLHAVPA 155 >SB_21111| Best HMM Match : WD40 (HMM E-Value=0.0047) Length = 96 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 450 SPDGQYLVTGSVDGVVEVWNLQR 518 S D Y T S DG V++W+LQ+ Sbjct: 56 SQDLMYFATASDDGTVKLWDLQK 78 >SB_19085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 555 Score = 27.9 bits (59), Expect = 8.6 Identities = 19/79 (24%), Positives = 34/79 (43%) Frame = +2 Query: 212 LPSQRPSPGRCPSYLVPSASTTGPGPQMATAPGSAPSRHHYRFVPW*SRNKRPRRRSLPH 391 +P RP+P C S VP P +P S+P++ + ++ P S+P Sbjct: 171 VPKPRPTPLPCQSQAVPDVQE--PVQSSEVSPISSPTQQEHLM----EASRPPDAPSVPF 224 Query: 392 PTVQDHQIRSEVPRGVRAI 448 H I++++ V A+ Sbjct: 225 DGFLSHLIKAKLDYAVAAV 243 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +2 Query: 215 PSQRPSPGRCP--SYLVPSASTTGPGPQMATAPGSAPS 322 PS SP P S PS+ST P P +P APS Sbjct: 927 PSSHQSPQSAPPSSPCTPSSSTAPPLPTNPKSPSEAPS 964 >SB_59679| Best HMM Match : Lectin_C (HMM E-Value=5.3e-10) Length = 849 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 179 TAAEEARSGAALPSQRPSPGRCP 247 T A + AA P +RP+PGR P Sbjct: 403 TPANPCNTPAAAPQRRPAPGRAP 425 >SB_59664| Best HMM Match : WD40 (HMM E-Value=2e-12) Length = 219 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/37 (29%), Positives = 26/37 (70%) Frame = +2 Query: 572 EEAVLSLAFARDSDTLAAGSNDGKIKVWKVSTGKVQR 682 ++ +LS+A++ + T+A+ S DG+I +W +++ + R Sbjct: 110 QDDILSVAYSPPT-TIASASYDGEIVIWNMNSEQASR 145 >SB_58364| Best HMM Match : WD40 (HMM E-Value=2.8026e-45) Length = 426 Score = 27.9 bits (59), Expect = 8.6 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 441 ARFSPDGQYLVTGSVDGVVEVWN 509 A ++P G Y+ +G + G V +W+ Sbjct: 64 AAYAPSGNYICSGDITGNVRIWD 86 >SB_39817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 503 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 176 HTAAEEARSGAALPSQRPSPG--RCPSYLVPSASTTGPGPQMATAP 307 +T+ + + A+ PSQ P P + P L AS P P AT+P Sbjct: 317 NTSVQLPKPQASQPSQVPRPQVPQAPQQLPWQASAPAPAPAKATSP 362 >SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 173 RHTAAEEARSGAALPSQRPSPGRCPS 250 RH R+ A+LPS PSP PS Sbjct: 41 RHPTCPHCRAKASLPSPSPSPSPSPS 66 >SB_11923| Best HMM Match : Toxin_3 (HMM E-Value=0.32) Length = 884 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 320 SRHHYRFVPW*SRNKRPRRRSLPHPTVQD 406 S H + W SRN PRR S P P D Sbjct: 561 STHAMDCIVWASRNAAPRRSSAPTPASTD 589 >SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 413 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 212 LPSQRPSPGRCPSYLVPSASTTGPGPQMATAPGSAP 319 LP+ RP P CP + S P P M P P Sbjct: 321 LPAMRPLPAMCPLPAMRPLSAMRPLPAMRPLPAMRP 356 >SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 417 GQKSHVECARFSPDGQYLVTGSVDGVVEVWNLQREKSVR 533 G V C +F D + +VTGS D + +W+++ +S+R Sbjct: 520 GHMDVVLCLQF--DRRRVVTGSSDRTIRMWDVRSGRSIR 556 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,831,470 Number of Sequences: 59808 Number of extensions: 582440 Number of successful extensions: 2381 Number of sequences better than 10.0: 109 Number of HSP's better than 10.0 without gapping: 1857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2359 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -