BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30249 (722 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces p... 28 1.6 SPCC1259.04 |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 27 3.6 SPAC25B8.19c ||SPAC683.01c|transcription factor, zf-fungal binuc... 26 4.7 SPCC1281.06c |||acyl-coA desaturase |Schizosaccharomyces pombe|c... 26 6.3 SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr... 25 8.3 SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr ... 25 8.3 >SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 723 Score = 27.9 bits (59), Expect = 1.6 Identities = 15/64 (23%), Positives = 31/64 (48%) Frame = +1 Query: 283 NANVLARYASICQSQRIVPIVEPEVLPDGEHDLDRAQKVTEVVLAAVYKALNDHHVYLEG 462 N+N LA+ + + ++++P+ P+ PD +++ + T ++ D E Sbjct: 325 NSNFLAKSTPLPEQEQLIPLEIPKDEPDSVDEINEENEETPEYDSSNSSYAQDSSTIPEK 384 Query: 463 TLLK 474 TLLK Sbjct: 385 TLLK 388 >SPCC1259.04 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 168 Score = 26.6 bits (56), Expect = 3.6 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = -2 Query: 541 LARATSLGVYVSCTTDRP----SPCWA*GVSPRGTRGGRSAPCTRRPERPQSPSGRGPGR 374 L++ T+L + T P SP + G+SP + + +R+ +R ++ G R Sbjct: 105 LSKLTALSKSTNSTLSTPKSFHSPLQSRGISPSSAQSSAAVSSSRKQKRKRTSEGPSERR 164 Query: 373 AR 368 AR Sbjct: 165 AR 166 >SPAC25B8.19c ||SPAC683.01c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 522 Score = 26.2 bits (55), Expect = 4.7 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Frame = +3 Query: 474 AQHG--DGRSVVQETYTPNDVA---RANVNRPSSAPCPP 575 A HG D V Q+ + P ANV+RP+ AP PP Sbjct: 45 AFHGSVDVPQVAQKAFDPQAATVSESANVSRPTPAPVPP 83 >SPCC1281.06c |||acyl-coA desaturase |Schizosaccharomyces pombe|chr 3|||Manual Length = 479 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 174 TSPSAAPSNRRTAATSPSGVAC*RSAAHPLVPSYPGKR 287 T+PSA + T + G A R P+VPS P ++ Sbjct: 2 TAPSATAFSSATTQPTTEGNASMRKRTIPVVPSVPERK 39 >SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/36 (27%), Positives = 23/36 (63%) Frame = +2 Query: 77 LEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 184 L+K+G++P V++ +ED+ +T+G++ L + Sbjct: 703 LKKQGVLPLTFVNEADYEKIDAEDKVSTRGIEQLLE 738 >SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 791 Score = 25.4 bits (53), Expect = 8.3 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 138 DRKTNAPPRVWTTSPSAAPSN-RRTAATSPSGVAC*RSAAHPLVPS 272 D+ + PP W T P++ + SG A +AA+P++PS Sbjct: 531 DKPFSCPP-TWNTGPNSLQQTIANSRPEGNSGSAKKAAAANPMIPS 575 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,110,387 Number of Sequences: 5004 Number of extensions: 67507 Number of successful extensions: 253 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 242 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -