BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30248 (817 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 22 5.1 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 6.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.9 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = +1 Query: 184 VYVMTATFDKCQLKFERLSL*KISNSSFVSISQWLSKFSRFLFRLNSV 327 V ++ ++KF + KIS S S L+ F LF+ + Sbjct: 341 VEILAVQVSNKKIKFSSFGMLKISRSLLTSFGGALTTFLVILFQYGGI 388 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 476 NMHLLIKIEVSKETFQLTYLNSLNYF 399 NMHLL + + T L +L + YF Sbjct: 190 NMHLLFLLCLDYFTLHLLFLPCIYYF 215 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +2 Query: 695 DPFPLLHSVSASLYTLAKPESRLVM 769 + +PLL +++ L AKP+ + ++ Sbjct: 2177 EEYPLLRTINRVLRGYAKPDPKCIL 2201 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,305 Number of Sequences: 336 Number of extensions: 3866 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -