BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30247 (501 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 1.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 1.2 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 23 1.2 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 4.7 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 6.2 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 23.4 bits (48), Expect = 1.2 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +3 Query: 291 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 413 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 233 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 280 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 485 IHLYLAFTSLLGGRTYFRFLGTADLLHSVLTFFTLF 378 IHL++ L+G + + L HSV F T+F Sbjct: 778 IHLFVKCVFLMGYQIFDWVQKEQSLAHSVGVFLTIF 813 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 23.4 bits (48), Expect = 1.2 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +3 Query: 291 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 413 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 15 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 62 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.4 bits (43), Expect = 4.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 72 RNSDYSHSQVHDQQIVGAQADGLRCFTS 155 R DY + + DQ +V +G+R +S Sbjct: 178 RCKDYKNEDLEDQPVVYNDVNGVRINSS 205 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 103 MTNRLLARKQMVCDVLHPGKPTV 171 +TN+ Q++ + LH KPTV Sbjct: 134 LTNKSNGNGQIMLNSLHKYKPTV 156 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,540 Number of Sequences: 336 Number of extensions: 2645 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -