BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30246 (783 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 30 0.33 SPAC25B8.11 |||transcription factor|Schizosaccharomyces pombe|ch... 27 4.0 SPAC12G12.15 |sif3||Sad1 interacting factor 3|Schizosaccharomyce... 26 5.3 SPCC330.02 |rhp7|SPCC613.14|Rad7 homolog Rhp7|Schizosaccharomyce... 25 9.3 SPAC1B3.05 |||CCR4-Not complex subunit Not3/5 |Schizosaccharomyc... 25 9.3 SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc... 25 9.3 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 30.3 bits (65), Expect = 0.33 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 219 TLNYF--FYNKELHLIQCTTTPHIFFYLKVVQRTQTQ*VHSIYISKPL*KRGNLPLLYH 389 T++YF ++ + + +CTTT IF YLK + + + YI KPL ++ L H Sbjct: 215 TVDYFSIYWISKCEISKCTTTEDIFSYLKNLIPSAEKSPAYNYILKPLRATAHVVLFRH 273 >SPAC25B8.11 |||transcription factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 654 Score = 26.6 bits (56), Expect = 4.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 254 SYPVYHDTTHLFLFKSGSKNTNTMSSFDLY 343 SYP+ H L +K+GS+N ++ LY Sbjct: 247 SYPILHGPRFLLSYKNGSRNVPSILLAALY 276 >SPAC12G12.15 |sif3||Sad1 interacting factor 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 510 Score = 26.2 bits (55), Expect = 5.3 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = -1 Query: 429 PYVQAMCSVEYFKYGRVVEDFRAFKEVLKYKSNELIVFVFFEPLL--NKKRCVVSWYTG* 256 P A C E F+ +V + + +V K +E++ V+ PL+ + C VS Sbjct: 143 PRATAYCVCEAFQLPKVKHFLKHYHKVRAKKYDEVLYAVYHLPLVYGRSESCRVSSGPAP 202 Query: 255 DEVPYYKKNN 226 D++P N+ Sbjct: 203 DDMPSSASNH 212 >SPCC330.02 |rhp7|SPCC613.14|Rad7 homolog Rhp7|Schizosaccharomyces pombe|chr 3|||Manual Length = 563 Score = 25.4 bits (53), Expect = 9.3 Identities = 9/44 (20%), Positives = 27/44 (61%) Frame = -1 Query: 627 ISMEHVSAALARRQPRNEFKLKLYLAASCLSTFMGELNRITSDA 496 ++M+ +S +++ + N+ +KL+L+ + + ++IT+D+ Sbjct: 215 VNMDKISQIISKNRSLNDTTVKLFLSGGQTELKLYDCSKITADS 258 >SPAC1B3.05 |||CCR4-Not complex subunit Not3/5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 25.4 bits (53), Expect = 9.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 685 NPQKKNLIRNPQSNLIIKLNKYGTRECGPCTPSAPK 578 N K LI+NP + L + +K + E T +APK Sbjct: 333 NITKPTLIQNPSTPLSVSNSKVASPETPNATHTAPK 368 >SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 25.4 bits (53), Expect = 9.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 79 QSVRLRNTLTLMQK-TVNEVYHNKFTRYRM 165 Q RL + L + +K T++E+ H+KF Y M Sbjct: 728 QEQRLLSFLRVYEKNTLSEIAHHKFNEYEM 757 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,338,897 Number of Sequences: 5004 Number of extensions: 69646 Number of successful extensions: 162 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -