BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30244 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. 23 7.6 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 23 7.6 >EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. Length = 169 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 529 LLCRDCA*FNNCNYVLNESTII 594 L+C++C FN Y LN + I+ Sbjct: 115 LICKECLPFNLVVYTLNPNYIM 136 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 653 LDFVFHWQSPNSSGTTSLDKLTGLSINLYF 742 +DF +H SP + K LS+NL F Sbjct: 1 MDFYYHPASPYCRSVMLVAKALKLSLNLQF 30 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 724,301 Number of Sequences: 2352 Number of extensions: 14073 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -