BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30243 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 24 3.7 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 24 3.7 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 4.8 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 6.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 6.4 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.4 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 8.4 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 8.4 AJ438610-2|CAD27474.1| 92|Anopheles gambiae hypothetical prote... 23 8.4 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 8.4 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 24.2 bits (50), Expect = 3.7 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +1 Query: 319 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 492 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 24.2 bits (50), Expect = 3.7 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +1 Query: 319 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 492 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 4.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 386 QQRSYWFGCEVQQGSRHCHSRR 451 ++R+YW+ E+ Q HC R Sbjct: 268 RRRAYWWTTEIAQCRSHCIEAR 289 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 6.4 Identities = 21/85 (24%), Positives = 31/85 (36%) Frame = +2 Query: 314 DHACTETNTCRTAHTFQGICCHWRQQRSYWFGCEVQQGSRHCHSRRYYPC*VVCFTSSKR 493 DHA T TC+T + G+ H + F E + H R Y +C +R Sbjct: 1805 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQR 1863 Query: 494 LLG*QIGKPHTVPCKVTGKCGSLTI 568 + + P T TG S + Sbjct: 1864 ISSMTV--PATSSVSTTGGSSSTMV 1886 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 6.4 Identities = 21/85 (24%), Positives = 31/85 (36%) Frame = +2 Query: 314 DHACTETNTCRTAHTFQGICCHWRQQRSYWFGCEVQQGSRHCHSRRYYPC*VVCFTSSKR 493 DHA T TC+T + G+ H + F E + H R Y +C +R Sbjct: 1806 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQR 1864 Query: 494 LLG*QIGKPHTVPCKVTGKCGSLTI 568 + + P T TG S + Sbjct: 1865 ISSMTV--PATSSVSTTGGSSSTMV 1887 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 329 LYRHDL*NLIIQGRAEE 279 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 329 LYRHDL*NLIIQGRAEE 279 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 329 LYRHDL*NLIIQGRAEE 279 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 329 LYRHDL*NLIIQGRAEE 279 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 329 LYRHDL*NLIIQGRAEE 279 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 329 LYRHDL*NLIIQGRAEE 279 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 258 EFEIIDFFLGPSLNDEVLKIMPV 326 + E ID F G L+ + LKI P+ Sbjct: 29 KLEYIDLFKGGHLSSDYLKINPL 51 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 562 NNPADSCPLRGTGNF 606 ++PA CP G GNF Sbjct: 239 SDPAAGCPRSGQGNF 253 >AJ438610-2|CAD27474.1| 92|Anopheles gambiae hypothetical protein protein. Length = 92 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 557 SLTIRL-IPAPFVVLGILSSPIPKKAFQ 637 SLT L IPA +VL + P P++ Q Sbjct: 39 SLTASLSIPAECIVLSVADEPSPERKVQ 66 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 329 LYRHDL*NLIIQGRAEE 279 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 705,010 Number of Sequences: 2352 Number of extensions: 14215 Number of successful extensions: 34 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -