BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30242 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 2.8 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 23 3.7 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 4.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.6 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 665 FGSSRVFRLKQHARFKLQRDGPELVAELKQPI 570 F +S +F+LKQH R + + L + K + Sbjct: 166 FKNSNIFQLKQHMRDTMNKIAETLDEDTKNKL 197 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 197 VRASQRMSIRLTVDYCRLRNDE 262 V +Q++SIR+T RLR+ E Sbjct: 111 VERAQQLSIRVTYASARLRSQE 132 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 154 QPAPRLWLHSLALNH*LVLVLTLCSEL 74 Q A +L SLA++ ++LVL L +EL Sbjct: 72 QTATNYYLFSLAISDLILLVLGLPNEL 98 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 129 WSHSLGAGCGL 161 WSH LG CGL Sbjct: 527 WSHVLGWLCGL 537 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 129 WSHSLGAGCGL 161 WSH LG CGL Sbjct: 580 WSHVLGWLCGL 590 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,192 Number of Sequences: 438 Number of extensions: 3948 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -