BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30241 (577 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02350.1 68418.m00158 DC1 domain-containing protein contains ... 30 1.3 At5g41390.1 68418.m05029 hypothetical protein contains 1 predict... 28 5.1 At3g60240.1 68416.m06732 MIF4G domain-containing protein / MA3 d... 27 6.8 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 27 6.8 At4g18150.1 68417.m02697 hypothetical protein 27 9.0 At2g22530.1 68415.m02672 phosphatidylinositolglycan-related simi... 27 9.0 At2g14830.1 68415.m01680 expressed protein contains Pfam profile... 27 9.0 >At5g02350.1 68418.m00158 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 651 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 164 YQSDECNREFHFRCLVSIRVLLMKLNHYTRVDKQLEKIFPSSDRS 30 Y D+C H RCL+ + + K H +K+ I P++ RS Sbjct: 574 YACDDCCTTLHVRCLLGEDMYMSKPGHTIMNNKREVHILPNNTRS 618 >At5g41390.1 68418.m05029 hypothetical protein contains 1 predicted transmembrane domain; Length = 297 Score = 27.9 bits (59), Expect = 5.1 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = +3 Query: 294 AIHL---LDSLHRAIHLLDSLHRTMHFLDTLQQAISHHIKSVHKTTNQPRIRMAMPALLM 464 AIHL + LHRAI L ++HR +H Q I K+V++ N RI++ + +L+ Sbjct: 202 AIHLPVTVTLLHRAIRQLRAIHRDIH----QHQDILQSNKNVNQNLNL-RIKVVISSLVC 256 Query: 465 S 467 S Sbjct: 257 S 257 >At3g60240.1 68416.m06732 MIF4G domain-containing protein / MA3 domain-containing protein similar to eukaryotic protein synthesis initiation factor [Homo sapiens] GI:3941724; contains Pfam profiles PF02854: MIF4G domain, PF02847: MA3 domain Length = 1544 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 356 SPMETVQKMYSSMETVQKMYSSTET 282 SP+ETV SS+ETV + SS ET Sbjct: 396 SPVETVPLAKSSVETVPPVKSSVET 420 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +2 Query: 416 NYQPATNSHGDASSINVGAGYSICGIKPSFSTMGQGSAGLQY 541 N Q +NS S G GY+ G P + MG G Y Sbjct: 302 NSQQQSNSGNSFGSQRGGGGYTRSGSAPDSAVMGSGQTHFTY 343 >At4g18150.1 68417.m02697 hypothetical protein Length = 762 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/23 (65%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = +2 Query: 389 QPSYQI--STQNYQPATNSHGDA 451 Q SYQI STQNY AT+S DA Sbjct: 440 QVSYQIDSSTQNYNSATDSKTDA 462 >At2g22530.1 68415.m02672 phosphatidylinositolglycan-related similar to Pig-o [Mus musculus] GI:8099973 Length = 897 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 384 AISHHIKSVHKTTNQPRIRMAMPALLMSELDIVFVE*NQALV 509 AI +H K+ T PR++ + + LD+ F QAL+ Sbjct: 114 AIGYHAKAAPPTVTMPRLKAMVSGAIGGFLDVAFNFNTQALL 155 >At2g14830.1 68415.m01680 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 454 Score = 27.1 bits (57), Expect = 9.0 Identities = 16/66 (24%), Positives = 34/66 (51%) Frame = +3 Query: 198 RADDVKDKREAPASYVHGHLHQAMHLLDSLRRAIHLLDSLHRAIHLLDSLHRTMHFLDTL 377 R + +K+K+ A +S++ + Q + + + RA+H L +L+ H +HF D + Sbjct: 94 RLNLLKNKKYAISSHLRNDIAQLLRIGER-DRALHRAQQLFLDENLMSLYHLLLHFSDII 152 Query: 378 QQAISH 395 +S+ Sbjct: 153 LLNLSY 158 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,971,180 Number of Sequences: 28952 Number of extensions: 245913 Number of successful extensions: 817 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1121903184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -